KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_1588Help
Entry
KPR_1588          CDS       T02793                                 

Gene name
wbaP
Definition
(GenBank) UDP-Gal::undecaprenolphosphate Gal-1-P transferase
  KO
K00996  undecaprenyl-phosphate galactose phosphotransferase [EC:2.7.8.6]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01005 Lipopolysaccharide biosynthesis proteins [BR:kpr01005]
    KPR_1588 (wbaP)
Enzymes [BR:kpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.8  Transferases for other substituted phosphate groups
    2.7.8.6  undecaprenyl-phosphate galactose phosphotransferase
     KPR_1588 (wbaP)
Lipopolysaccharide biosynthesis proteins [BR:kpr01005]
 O-antigen
  KPR_1588 (wbaP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Bac_transf CoA_binding_3
Motif
Other DBs
NCBI-ProteinID: CCI75818
UniProt: A0A0N5EB01
Position
1674784..1676211
Genome map
AA seq 475 aa AA seqDB search
MTHFSKNVSCSVALALADFVSFVLSLYLALGVLSVTLPDFHQRVPKNQIEGWIGLHWLLG
ACCVVWYGVRLRHYFYRKTFWFELKEILRTLAIFAVIEMAVMAFANWYFSRYAWLLTWLF
AAALVPFVRMSVKYVLNTFGLWMRDTWIIGSGKNAQEAYKAINSENNLGLNVVGFISNAE
DNKLGMMIDGIQVIQPDTTWIKNIDKRAQFIVAVESHQSDIRNKWLREFMIRGYRYVSVI
PTLRGMPLDSTDMSFIFSHEVMIFRVQQNLAKWSSRILKRTFDIVGALGIILLLSPLLIY
ISRKVRKDGGTAIYGHERVGKGGKPFKCLKFRSMVVNSKEVLEELLANDPEVKAEWDATF
KLKNDPRITSIGHFLRRTSLDELPQLFNVLKGEMSLVGPRPIITAELERYNDEVDYYLLS
KPGMTGLWQVSGRSDVDYDTRVYLDAWYVKNWSMWNDIAILFKTINVVLKKDGAY
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgacgcatttttcaaaaaacgtaagttgtagcgtggcgttggctttggcggacttcgtt
agctttgtgctttcgttgtacttggcattaggagtactttcggtaactctacctgatttc
catcagcgagttccaaaaaaccaaatagaggggtggattggactgcactggttattaggg
gcgtgttgcgtagtatggtatggtgttcgtttacgtcattatttttaccgtaaaactttt
tggttcgaattaaaagagatattacgtactctggctatttttgcagtaatagaaatggct
gtgatggcatttgccaactggtatttttccaggtatgcatggcttttgacttggcttttt
gcagctgcgttggtgccttttgtaaggatgtcagtcaaatatgtgctaaatacttttggg
ctttggatgcgtgatacctggattattggtagcgggaagaatgcacaggaggcatataaa
gcaattaatagtgaaaataatctggggttaaatgtagttggatttatcagcaatgctgag
gataataaattaggcatgatgattgatggtattcaagttattcagcctgatactacttgg
ataaaaaatattgataaaagggcacagttcattgttgcagttgagtcccaccaaagtgat
atccgtaataaatggttgcgcgaatttatgattcgtggatatcgctatgtatcggtaatt
ccaactctacgtggtatgccattagatagcactgacatgtcattcatctttagtcatgaa
gtaatgatatttcgagttcagcaaaatttagctaaatggtcatcgagaattcttaagcgt
acatttgatattgttggggctctgggaataattcttcttctttcgccattattaatttat
attagtagaaaggtaagaaaggacggcggtacagctatatacgggcatgagcgtgtaggt
aagggtggtaaaccatttaaatgcctcaaattccgttcaatggttgtaaattctaaagaa
gtattagaagagctgttggcaaatgatccagaagtaaaagcagaatgggatgcaactttc
aaactgaaaaacgatcctcgcattactagtattggtcattttttacgtaggacaagtttg
gatgaacttcctcaattgttcaatgtgcttaaaggggagatgagtttagtagggccacgg
ccgatcattacagcggagttagagcgatataacgatgaggtcgactactatctattaagt
aaacctgggatgactgggctatggcaggtgagcgggcgtagtgatgtcgattatgatact
cgtgtgtacttggatgcgtggtatgtaaaaaactggtctatgtggaatgatatcgcaatc
ttgttcaaaaccataaatgttgtattaaaaaaagatggcgcttattga

DBGET integrated database retrieval system