KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_1785Help
Entry
KPR_1785          CDS       T02793                                 

Definition
(GenBank) unnamed protein product; highly similar to glycoside hydrolase family protein from Enterobacter cloacae (tr|D5C991)
  KO
K05350  beta-glucosidase [EC:3.2.1.21]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00460  Cyanoamino acid metabolism
kpr00500  Starch and sucrose metabolism
kpr01100  Metabolic pathways
kpr01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    KPR_1785
  09106 Metabolism of other amino acids
   00460 Cyanoamino acid metabolism
    KPR_1785
Enzymes [BR:kpr01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.21  beta-glucosidase
     KPR_1785
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: CCI76015
UniProt: R4YEE2
Position
1877852..1879279
Genome map
AA seq 475 aa AA seqDB search
MTTVRMTIPDDFILGAAASAWQTEGWSGKKPGQDSWPDLWYKNDRHVWHNGYGPAVATDF
INRFQEDVQLMKLAGLTHYRTSINWSRFLTDYENVTVDEEYAAYYDQLFDALLANGITPM
ICLEHYELPGYLLEKYGGWGSKTVVELFVRYAEKVFARYHPKVTRWFTFNEPIVVQTRVY
LDALRWPYEQNTSTWMQWNYHKVLATASVVKRFRELGYPGTVGCILNPEVTYPRSRAPHD
LRAAEIYDLFYNRMFLDPLVHGVWPPELLALLEQHQVTWETSEEDLAVIREHTVDELGIN
LYYPHRVKAPSRAWHPHTPFHPAWYYEPFELPGRRMNASRGWEIYPQIIFDMAMRIKNDY
RNIPWFVAESGMGVENEGQFRNREGVIDDSYRIRFISEHLWHTLRAREAGANCQGYMLWA
FTDNVSPMNAFKNRYGLIEIDLQNHRARRPKASAHWFRQLGERRELVLDIDDEYR
NT seq 1428 nt NT seq  +upstreamnt  +downstreamnt
atgactaccgtacggatgaccattcccgatgattttatccttggcgcggcggcttccgcc
tggcagaccgaaggctggagcgggaaaaaaccagggcaggactcctggcccgatctctgg
tacaaaaacgatcgccacgtctggcataacggctatggcccggcggtggccaccgatttt
atcaaccgctttcaggaagatgtgcagctgatgaagctggccgggctgacccactaccgc
acctcaatcaactggtcgcgctttctgaccgactatgaaaacgtcacggtggatgaggag
tatgcggcctattacgaccagctgttcgatgcgctactggccaacggcatcacgccgatg
atctgccttgagcattatgaattgcccggctatctgctggaaaagtatggcggctggggg
tcgaaaacggtggttgagctgtttgtgcgctacgcggagaaggtgtttgcccgctaccac
ccgaaggtaacgcgctggtttacctttaatgagccaattgtggtgcagacccgggtctat
ctggatgctctgcgctggccctatgagcagaacaccagcacctggatgcagtggaactat
cataaggtgctggcgaccgccagcgtcgtgaagcggtttcgcgagctcggctatcccggg
accgtcggctgcatcctcaatccggaggtgacctacccacgctcacgcgccccccatgac
ctgcgcgcggcggagatctacgatctgttctacaaccgcatgttcctcgacccgctggtg
cacggcgtctggccgccggagcttctcgcgctgcttgagcagcatcaggttacgtgggag
accagcgaggaagatctggcggttatccgcgagcacaccgtcgatgagctggggattaat
ctttactacccgcaccgggtcaaagccccgtcgcgggcctggcatccgcataccccgttc
catccggcctggtattatgagccgtttgagctgcccggccggcggatgaacgcctcccgc
ggctgggaaatctacccgcaaatcatctttgatatggcgatgcggataaaaaatgactat
cgcaacatcccgtggttcgtggcggagagcgggatgggggtggaaaacgaaggccagttc
cgtaaccgcgaaggcgtcatcgatgacagctaccgcattcgttttatcagcgaacatctg
tggcacaccctgcgcgcccgcgaggcaggggccaactgccagggctatatgctgtgggcg
tttaccgacaacgtatcgccgatgaacgcctttaaaaaccgctacgggcttatcgaaatc
gatctgcaaaaccatcgcgcccggcgacccaaagcctcggcgcactggtttcgtcaactg
ggcgaacggcgtgaactggtgctggatatcgatgatgaataccgctag

DBGET integrated database retrieval system