KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_2597Help
Entry
KPR_2597          CDS       T02793                                 

Gene name
thlA
Definition
(GenBank) highly similar to acetyl-CoA acetyltransferase thlA from Enterobacter helveticus (tr|C7C587)
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00071  Fatty acid degradation
kpr00072  Synthesis and degradation of ketone bodies
kpr00280  Valine, leucine and isoleucine degradation
kpr00310  Lysine degradation
kpr00362  Benzoate degradation
kpr00380  Tryptophan metabolism
kpr00620  Pyruvate metabolism
kpr00630  Glyoxylate and dicarboxylate metabolism
kpr00640  Propanoate metabolism
kpr00650  Butanoate metabolism
kpr00900  Terpenoid backbone biosynthesis
kpr01100  Metabolic pathways
kpr01110  Biosynthesis of secondary metabolites
kpr01120  Microbial metabolism in diverse environments
kpr01130  Biosynthesis of antibiotics
kpr01200  Carbon metabolism
kpr01212  Fatty acid metabolism
kpr02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPR_2597 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    KPR_2597 (thlA)
   00640 Propanoate metabolism
    KPR_2597 (thlA)
   00650 Butanoate metabolism
    KPR_2597 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KPR_2597 (thlA)
   00072 Synthesis and degradation of ketone bodies
    KPR_2597 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPR_2597 (thlA)
   00310 Lysine degradation
    KPR_2597 (thlA)
   00380 Tryptophan metabolism
    KPR_2597 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPR_2597 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPR_2597 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPR_2597 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpr04147]
    KPR_2597 (thlA)
Enzymes [BR:kpr01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPR_2597 (thlA)
Exosome [BR:kpr04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPR_2597 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HemY_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: CCI76827
UniProt: R4YGL7
Position
complement(2678510..2679700)
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVIVSGVRTAIGTFNGSLKHTHQHDLGAAVILEAIARAGIAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVVACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLISILTWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEGRFREQILALEVPDGKKATRLFATDEHPRDTPREKLATLRPAFKAD
GVVTAANSSGINDGAAALVMMTRQQAEKRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNIDVQSIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctaatgatattgtgattgtcagcggcgtccgtaccgctattggcacgttt
aacggcagtcttaaacatacccatcagcatgaccttggggccgctgtcattctcgaagcg
atcgcccgcgccgggattgcgccgcaggatatcgacgaaacgatcgtcggcaacgtcggg
caaatcgccgaaagcggttttatcgcccgcatctgtcagctgcgcgcggggatcccgcag
gagagcaccgcctattccgttaaccgccagtgtggttccggacttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggccgaggtggtcgtcgcctgcggcactgaaaat
atgacccagctgccctactacctgcgtaaagcgcgcgatggttatcgcatgggccatggc
gagctggaagatggcctgatctccattctcacctggccggaaggcccttatcacaacggc
atcaccgcggaaaacgtcgcgcaacgcttcggtattacccgcgaagcgatggacgatttc
gcctggtcgagccagcagaaggcgctgaaggcgatcgcggagggtcgttttcgcgagcag
atcctggcccttgaggtgccggacggcaaaaaagcgacccgcctgtttgcgaccgatgaa
cacccgcgcgacaccccgcgtgaaaagctcgccacgctgcgtccggcgtttaaagccgac
ggcgtggtgacggcggccaactcatcgggcattaacgacggcgcggcggcgctggtgatg
atgacccgccagcaggcggaaaaacgcggcttaaccccgcgcatgcgcattcgcggctgg
gcggtcgccggctgcggggcggagattatggggtttggtccctctcccgctacccgacgc
ctgatggaccgtctcaatatagatgtgcagtccattgatttaattgaactcaatgaggcc
ttcgccgctcaggcgctggcggtgatgaacgatctgcgtctcgacccggcccgcgttaac
gtcaacggcggcgcgatcgctctcggccacccggtaggcgccagcggtgcgatcctgccg
gtcaaactgatgtatgaaatggcgcgcagcggcgcacgcactggtctggtcaccatgtgc
atcggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system