KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_3677Help
Entry
KPR_3677          CDS       T02793                                 

Gene name
ltaE
Definition
(GenBank) highly similar to low specificity L-threonine aldolase from Escherichia coli strain K12 (sp|P75823)
  KO
K01620  threonine aldolase [EC:4.1.2.48]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00260  Glycine, serine and threonine metabolism
kpr01100  Metabolic pathways
kpr01110  Biosynthesis of secondary metabolites
kpr01120  Microbial metabolism in diverse environments
kpr01130  Biosynthesis of antibiotics
kpr01230  Biosynthesis of amino acids
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPR_3677 (ltaE)
Enzymes [BR:kpr01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.48  low-specificity L-threonine aldolase
     KPR_3677 (ltaE)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Beta_elim_lyase Aminotran_1_2 DegT_DnrJ_EryC1 Cys_Met_Meta_PP
Motif
Other DBs
NCBI-ProteinID: CCI77905
UniProt: R4YCF2
Position
3778278..3779279
Genome map
AA seq 333 aa AA seqDB search
MIDLRSDTVTRPGRAMLEAMMAAPVGDDVYGDDPTVNELQRYAADLAGKEAALFLPTGTQ
ANLVGLLSHCQRGEEYIVGQGAHNYLYEAGGAAVLGSIQPQPIDAAADGSLPLDKVAAKI
KPDDIHFAPTRLLSLENTHNGKVLPRDYLQEAWAFTRQRNLALHVDGARIFNAVVAYGCE
LRDIAQYCDSFTICLSKGLGAPVGSLLLGSEAYIRRAVRWRKMVGGGMRQAGILAAAGLY
ALKNNVQRLQEDHDNAAWMAEQLRAIGAEVTRHDTNMLFVRVGEEQAPALGKFMQAQGVL
INASPVVRLVTHLDVNRQQLSEVVAHWQAFLQR
NT seq 1002 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgatttacgcagtgataccgttacccgtcccgggcgcgccatgctggaggccatg
atggccgccccggtcggggacgatgtgtatggcgacgaccctaccgtcaatgaactgcag
cgctatgccgccgacctggccggcaaagaagcggcgctatttctacccaccggcacccag
gccaacctcgttggcctgctcagccattgccagcgcggcgaagagtatatcgtcggccag
ggggcgcataactatctgtacgaagccggcggcgcggcggtcctcggcagtattcagccg
cagccgatcgacgccgcggcggatggttcgctgccgctggataaagtggcggcgaaaatc
aaacccgacgatatccattttgcccccacccgcctgctgagcctggaaaacacccataac
ggtaaggtgctgccgcgcgactatctgcaggaagcctgggcgtttacccgccagcgcaat
ctggcgctgcacgtcgacggcgcacgcatctttaacgccgtggtggcctacggctgcgag
ttacgtgatatcgcccaatactgcgactccttcaccatctgcctgtcaaaggggcttggc
gctccggtaggctcgttgctgctcggcagcgaggcgtacattcgccgcgccgtccgctgg
cggaaaatggtcggcggcgggatgcgccaggcgggcatcctggccgccgccgggctgtac
gcgctgaaaaataacgtgcagcgcctgcaggaggatcatgacaacgccgcgtggatggcg
gagcagctgcgcgctatcggcgccgaggtcacccgtcacgataccaacatgctgttcgtt
cgcgtcggcgaagagcaggccccggcgctcggcaagtttatgcaggcgcagggggtattg
attaacgcctcgcctgttgtccgtctggtcactcacttggatgtcaaccgtcagcagctg
agcgaggtggtcgcccactggcaggcttttttacaacgctaa

DBGET integrated database retrieval system