KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_4143Help
Entry
KPR_4143          CDS       T02793                                 

Gene name
truC
Definition
(GenBank) highly similar to tRNA pseudouridine synthase C from Shigella flexneri (sp|P0AA42)
  KO
K06175  tRNA pseudouridine65 synthase [EC:5.4.99.26]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Brite
KEGG Orthology (KO) [BR:kpr00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kpr03016]
    KPR_4143 (truC)
Enzymes [BR:kpr01000]
 5. Isomerases
  5.4  Intramolecular transferases
   5.4.99  Transferring other groups
    5.4.99.26  tRNA pseudouridine65 synthase
     KPR_4143 (truC)
Transfer RNA biogenesis [BR:kpr03016]
 Prokaryotic Type
  tRNA modification factors
   Psudouridine synthases
    KPR_4143 (truC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PseudoU_synth_2
Motif
Other DBs
NCBI-ProteinID: CCI78371
UniProt: R4YDR1
Position
complement(4271474..4272268)
Genome map
AA seq 264 aa AA seqDB search
MLEIIYQDDWLVAVNKPSGWLVHRSWLDRDEKVVVMQTVRDQIGQHVFTAHRLDRPTSGV
LLMGLSSEAGRLLAQQFEQHQIRKRYHAIVRGWLMEEALLDYPLVEELDRIADKFAREDK
GPQPAVTHYRGLATVEMPVATGRYPTSRYGLVELEPKTGRKHQLRRHLAHLRHPILGDSK
HGDLRQNRSAAEHFGCHRLMLHASELSLTHPFTGEPLTLRAGFDDVWMRALSQFGWRGLL
PLNERVEFADDSGQDEENKVNPGR
NT seq 795 nt NT seq  +upstreamnt  +downstreamnt
atgctggagattatctaccaggacgactggctggtggcggtcaacaaaccctcgggctgg
ctggtgcatcgcagctggctcgatcgcgacgagaaagtggtggtgatgcagaccgtgcgc
gaccagatcggtcagcacgtttttaccgctcatcgtctcgaccggcccacctccggcgtg
ctgctgatgggattgtcgagtgaggcgggccggctgctggcgcaacagttcgagcagcac
cagatccggaagcgctaccatgcgatcgtccgcggctggctgatggaagaggcgctgctg
gattacccgctggtagaggagctggatagaatcgccgataagttcgcccgcgaagataaa
gggccgcagccagcggtaacccactaccgcggtctggcgacagtggagatgccagtggcg
actgggcgctatcccacctcgcgctatgggctggtggaactggagccgaaaaccggccgc
aagcaccagctgcgccgtcatctggcccacctccgtcatccgatcctcggcgacagcaag
cacggcgatctgcggcaaaaccgcagcgccgcggaacatttcggctgtcaccgcctgatg
ctgcacgccagcgagctgtcattaacccatccttttaccggcgagccgctgaccctgcgc
gccggttttgacgacgtctggatgcgcgcgctgtcgcagtttggctggcgcgggcttctc
ccgctaaatgaaagggttgagtttgccgacgacagcggtcaggatgaagagaataaggtc
aatccagggagataa

DBGET integrated database retrieval system