KEGG   Klebsiella pneumoniae subsp. rhinoscleromatis SB3432: KPR_4444Help
Entry
KPR_4444          CDS       T02793                                 

Gene name
proB
Definition
(GenBank) highly similar to glutamate 5-kinase from Klebsiella pneumoniae subsp. pneumoniae strain ATCC 700721 - MGH 78578 (sp|A6T562)
  KO
K00931  glutamate 5-kinase [EC:2.7.2.11]
Organism
kpr  Klebsiella pneumoniae subsp. rhinoscleromatis SB3432
Pathway
kpr00330  Arginine and proline metabolism
kpr00332  Carbapenem biosynthesis
kpr01100  Metabolic pathways
kpr01130  Biosynthesis of antibiotics
kpr01230  Biosynthesis of amino acids
Module
kpr_M00015  Proline biosynthesis, glutamate => proline
Brite
KEGG Orthology (KO) [BR:kpr00001]
 Metabolism
  Amino acid metabolism
   00330 Arginine and proline metabolism
    KPR_4444 (proB)
  Biosynthesis of other secondary metabolites
   00332 Carbapenem biosynthesis
    KPR_4444 (proB)
Enzymes [BR:kpr01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.11  glutamate 5-kinase
     KPR_4444 (proB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AA_kinase PUA
Motif
Other DBs
NCBI-ProteinID: CCI78672
UniProt: R4YDY9
Position
4570529..4571632
Genome map
AA seq 367 aa AA seqDB search
MSESQTLVVKLGTSVLTGGSRRLNRAHIVELVRQCAQLHAMGHRIVIVTSGAIAAGREHL
GYPELPATIASKQLLAAVGQSRLIQLWEQLFSIYGIHVGQMLLTRADMEDRERFLNARDT
LRALLDNSIVPVINENDAVATAEIKVGDNDNLSALAAILAGADKLLLLTDQPGLFTADPR
SNPQAELIKDVYGIDDALRAIAGDSVSGLGTGGMGTKLQAADVACRAGIDTIIAAGNRPD
VIGHAMAGLPVGTCFHAQESPLENRKRWIFGAPPAGEITVDAGATQAILERGSSLLPKGI
KIVSGNFSRGEVIRIRNSEGRNIAHGVSRYNSDALRLIAGQHSQQIDAILGYEYGPVAVH
RDDMIIR
NT seq 1104 nt NT seq  +upstreamnt  +downstreamnt
atgagtgaaagccagacgctggtggtaaaactgggcaccagtgttttaacaggcgggtcc
cgtcgcctgaaccgcgcccatatcgtcgagcttgtgcgccagtgcgcacagttgcacgcc
atgggacaccgtattgtcatcgtgacctccggggccattgccgccgggcgcgagcacctt
ggttacccggaactgcccgccaccatcgcctccaagcagctgctggcggcggtgggacaa
agccgtctgatccagctgtgggaacagctgttttctatctatggcattcacgttggccag
atgctgctgacccgcgccgacatggaagacagagaacggttcctcaacgcccgcgacact
ctgcgcgcgctgctggataacagcatcgtcccggtcattaacgaaaacgacgccgtcgcc
accgcggaaatcaaagtgggcgataacgacaatctctccgcgctggccgcgatcctcgcc
ggggcggataagctgctgctgttaaccgaccagccaggcctgttcactgccgacccgcgc
agcaacccgcaggcggagctgattaaagacgtctacggcatcgacgacgcgctgcgcgcc
atcgccggcgatagcgtctccggactcggcaccggcggcatgggcaccaagctgcaggcc
gcggacgtcgcctgccgggcggggattgataccatcatcgccgccgggaaccgtccggac
gtcatcggccatgccatggcaggcctgccggtaggtacctgcttccacgcccaggagtct
ccgctggagaaccgtaagcgctggatcttcggcgcgccgccggcgggggaaatcaccgtc
gatgcgggcgcgacccaggcgatcctcgaaagaggcagctcgctattgccaaaaggcatc
aaaatcgtcagcggcaacttctcccgcggcgaagtgatccgcatccgcaatagcgaagga
cgcaacatcgctcacggcgtcagccgctacaatagcgatgcgctgcgccttatcgccggc
cagcactcgcagcaaatcgatgccattctgggctatgaatacggcccggtggccgtccac
cgcgatgatatgatcatccgttaa

DBGET integrated database retrieval system