KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_00464Help
Entry
KPNJ2_00464       CDS       T03177                                 

Definition
(GenBank) LSU ribosomal protein L22P
  KO
K02890  large subunit ribosomal protein L22
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps03010  Ribosome
Brite
KEGG Orthology (KO) [BR:kps00001]
 09120 Genetic Information Processing
  09122 Translation
   03010 Ribosome
    KPNJ2_00464
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03011 Ribosome [BR:kps03011]
    KPNJ2_00464
Ribosome [BR:kps03011]
 Ribosomal proteins
  Mitochondria/ Chloroplast
   Large subunit
    KPNJ2_00464
  Bacteria
    KPNJ2_00464
  Archaea
    KPNJ2_00464
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ribosomal_L22
Motif
Other DBs
NCBI-ProteinID: AHM77244
UniProt: W8UBH1
Position
475153..475485
Genome map
AA seq 110 aa AA seqDB search
METLAQHRHARSSAQKVRLVADLIRGKKVSQALDILTYTNKKAAVLVKKVLESAIANAEH
NDGADIDDLKVAKIFVDEGPSMKRIMPRAKGRADRILKRTSHITVVVSDR
NT seq 333 nt NT seq  +upstreamnt  +downstreamnt
atggaaactttagctcaacatcgccatgctcgttcttctgctcagaaggttcgccttgta
gctgacctgattcgcggtaagaaagtgtcgcaggccctggatattctgacctacaccaac
aaaaaagctgctgtactggtcaagaaggtactggaatctgccattgctaacgctgaacac
aacgatggcgctgacattgatgatctgaaagttgcgaaaattttcgtagacgaaggcccg
agcatgaagcgcattatgccgcgtgctaaaggtcgtgcagatcgcatcctgaagcgcacc
agccacatcactgtggttgtgtccgatcgctga

DBGET integrated database retrieval system