KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_01014Help
Entry
KPNJ2_01014       CDS       T03177                                 

Definition
(GenBank) Sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00052  Galactose metabolism
kps00500  Starch and sucrose metabolism
kps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kps00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KPNJ2_01014
   00500 Starch and sucrose metabolism
    KPNJ2_01014
Enzymes [BR:kps01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KPNJ2_01014
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AHM77794
UniProt: W8UCZ1
Position
979448..980890
Genome map
AA seq 480 aa AA seqDB search
MKMMTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHP
YSTQWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKF
HGDPGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDCWYMIVGAR
EGDTGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAG
FSNRNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFSTPDGRRIVIGWLDMWE
SPLPEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVD
NCEAMEVNLRWDCARSSAEQYGLRFGDGLRIYMDAQQQRLVLERHYPQYGLCGTRSVPLT
AGADLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPRRELALFAWSGAAALTEAGAWQLE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgatgacttacacaatctcccgggctgaacaggtactccagacacaacgccag
gcgcttaatctgcgctggtatccgcactatcacctggcggcccgcgccgggtggatcaac
gacccaaacggtctggtgtggtttgacggctggtaccatgccttttatcaacatcacccg
tactccacccagtggggaccgatgcactgggggcacgcgcgcagtaaggatctggtgcac
tgggagcatttgccggtagccctggcgccggagggcccggaggataaagacggctgcttt
tccggctcggcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttc
cacggcgatcctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgc
gacgggatccactttgagcgccaggggatggtggtcgacaccccgccgggtatgcaccac
ttccgtgacccgaaggtctggcgtgaaggagactgctggtacatgatcgtcggcgcgcgc
gaaggcgataccggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggac
gcgggggtgctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttc
ttcaccctcaacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcgggg
ttcagcaaccgcaatctgttccagagcggctatctgatcggcgagtggcagccaggccag
cgttttattcgccatggcgaattccgggagatggataacggccacgatttctatgccccg
caaagcttctccacccccgatggccggcggatcgtgattggctggctggatatgtgggaa
tcgccgctgccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctg
agcctgagcgcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgc
ggcgcctggttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgac
aactgcgaggcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcag
tatggtctgcgctttggcgatggcctgcgcatctacatggatgcccaacagcagcgtctg
gtgctggaacggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgacc
gccggggcggatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtc
aatgacggcgaagcctgcctgagcagccgtatctatccgcaggctccccgccgtgaatta
gcgttatttgcctggagcggcgcggcggcattaaccgaagccggcgcctggcagctcgaa
taa

DBGET integrated database retrieval system