KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_01172Help
Entry
KPNJ2_01172       CDS       T03177                                 

Definition
(GenBank) Vanillate decarboxylase VdcB protein
  KO
K03186  flavin prenyltransferase [EC:2.5.1.129]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00130  Ubiquinone and other terpenoid-quinone biosynthesis
kps00627  Aminobenzoate degradation
kps01100  Metabolic pathways
kps01110  Biosynthesis of secondary metabolites
kps01120  Microbial metabolism in diverse environments
kps01220  Degradation of aromatic compounds
Module
kps_M00117  Ubiquinone biosynthesis, prokaryotes, chorismate => ubiquinone
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    KPNJ2_01172
  09111 Xenobiotics biodegradation and metabolism
   00627 Aminobenzoate degradation
    KPNJ2_01172
Enzymes [BR:kps01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.129  flavin prenyltransferase
     KPNJ2_01172
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Flavoprotein
Motif
Other DBs
NCBI-ProteinID: AHM77952
UniProt: W8UVJ2
Position
1141035..1141640
Genome map
AA seq 201 aa AA seqDB search
MRSGMKLIIGMTGATGAPLGVALLQALRDMPEVETHLVMSKWAKTTIELETPWTAREVAA
LADFSHSPADQAATISSGSFRTDGMIVIPCSMKTLAGIRAGYAEGLVGRAADVVLKEGRK
LVLVPREMPLSTIHLENMLALSRMGVAMVPPMPAYYNHPETVDDITNHIVTRVLDQFGLD
YHKARRWNGLRTAEQFAQEIE
NT seq 606 nt NT seq  +upstreamnt  +downstreamnt
atgaggtctggaatgaaactgattattgggatgacgggggccaccggggcaccgcttggg
gtggcattgctgcaggcgctgcgcgatatgccggaggtggaaacccatctggtgatgtcg
aaatgggccaaaaccaccatcgagctggaaacgccctggacggcgcgcgaagtggccgcg
ctggcggacttttcccacagcccggcagaccaggccgccaccatctcatccggttcattt
cgtaccgacggcatgatcgttattccctgcagtatgaaaacgcttgcaggcattcgcgcg
ggttatgccgaagggctggtgggccgcgcggcggacgtggtgctcaaagaggggcgcaag
ctggtgttggtcccgcgggaaatgccgctcagcacgatccatctggagaacatgctggcg
ctgtcccgcatgggcgtggcgatggtcccgcccatgccagcttactacaaccacccggag
acggttgacgatatcaccaatcatatcgtcacccgggtgctggatcagtttggcctcgac
tatcacaaagcgcgccgctggaacggcttacgcacggcagaacaatttgcacaggagatc
gaataa

DBGET integrated database retrieval system