KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_01766Help
Entry
KPNJ2_01766       CDS       T03177                                 

Definition
(GenBank) Methionyl-tRNA synthetase
  KO
K01874  methionyl-tRNA synthetase [EC:6.1.1.10]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00450  Selenocompound metabolism
kps00970  Aminoacyl-tRNA biosynthesis
kps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00450 Selenocompound metabolism
    KPNJ2_01766
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KPNJ2_01766
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kps01007]
    KPNJ2_01766
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kps03016]
    KPNJ2_01766
Enzymes [BR:kps01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.10  methionine---tRNA ligase
     KPNJ2_01766
Amino acid related enzymes [BR:kps01007]
 Aminoacyl-tRNA synthetase
  Class I (U)
   KPNJ2_01766
Transfer RNA biogenesis [BR:kps03016]
 Eukaryotic type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KPNJ2_01766
 Prokaryotic type
   Other AARSs
    KPNJ2_01766
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1g tRNA_bind tRNA-synt_1 tRNA-synt_1e tRNA-synt_1f Anticodon_1
Motif
Other DBs
NCBI-ProteinID: AHM78546
UniProt: W8VFK9
Position
complement(1736100..1738181)
Genome map
AA seq 693 aa AA seqDB search
MVISEALFTTEDVMLTMTQVAKKILVTCALPYANGSIHLGHMLEHIQADVWVRYQRMRGH
EVNFICADDAHGTPIMLKAQQLGITPEQMIGEMSQEHQTDFAGFDISYDNYHSTHSDENR
ELSELIYTRLKENGFIKNRTISQLYDPEKGMFLPDRFVKGTCPKCKSPDQYGDNCEVCGA
TYSPTELIDPKSVVSGATPVMRDSEHFFFDLPSFSEMLQAWTRSGALQEQVANKMQEWFE
SGLQQWDISRDAPYFGFEIPNAPGKYFYVWLDAPIGYMGSFKNLCDKRGDTTSFDEYWKK
DSTAELYHFIGKDIVYFHSLFWPAMLEGSNFRKPTNLFVHGYVTVNGAKMSKSRGTFIKA
STWLNHFDADSLRYYYTAKLSSRIDDIDLNLEDFVQRVNADIVNKVVNLASRNAGFISKR
FDGVLAAELADPALYKTFTDAAESIGEAWDSREFGKAIREIMALADVANRYVDEQAPWVV
AKQEGRDADLQAICTMGLNMFRVLMTWLKPVLPQLAARAEAFLNSELSWDAIQQPLLAHK
VNPFKALYNRIEMKQVEALVEASKEEVKATAAPVTGPLADDPIQETITFDDFAKVDLRVA
LIENAEFVEGSDKLLRLTLDLGGEKRNVFSGIRSAYPDPQPLIGRLTVMVANLAPRKMRF
GISEGMVMAAGPGGKDIFLLSPDDGAKPGQQVK
NT seq 2082 nt NT seq  +upstreamnt  +downstreamnt
ttggtaatatcggaagccctttttacaacagaagatgtaatgctcactatgactcaagtc
gcgaagaaaattctggtaacgtgcgccctgccgtacgccaacggctccatccacctcggc
cacatgctggagcacatccaggctgatgtctgggtccgttaccagcgaatgcgcggccac
gaggtcaacttcatctgcgccgacgacgcccacggcacgccgatcatgctcaaagcgcag
cagctcggtatcacaccggagcagatgattggcgaaatgagtcaggagcatcagaccgat
ttcgccggcttcgacatcagctatgataactatcactcgacgcacagcgacgagaaccgc
gagctgtcggagcttatctacacccgcctgaaagagaacggttttattaaaaaccgcacc
atctctcagctctacgatccggaaaaaggcatgttcctgccggaccgttttgtgaaaggc
acctgtccgaagtgcaaatctccggaccagtatggcgataactgcgaagtgtgcggcgcg
acctacagccctaccgagcttatcgacccgaaatcggtggtctccggcgccacgccggtg
atgcgtgactccgagcactttttcttcgacctgccgtcgttcagcgaaatgctgcaggcg
tggacccgcagcggcgccctgcaggagcaggtcgcgaacaagatgcaggagtggttcgaa
tccggcctgcagcagtgggacatctcccgcgatgcgccgtacttcggcttcgaaattccc
aacgcgccgggcaaatatttctacgtctggctggacgcgccgatcggctacatgggctcc
ttcaagaacctgtgcgacaagcgcggcgacaccaccagcttcgacgaatactggaagaaa
gattctacggccgagctgtatcactttatcggcaaagacattgtctacttccacagcctg
ttctggccggcgatgctggaaggcagcaacttccgtaagccgactaacctgttcgtgcac
ggctacgtgacggttaacggcgccaagatgtccaagtcgcgcggcacctttatcaaggcc
agcacctggttaaatcatttcgatgccgacagcctgcgctactactacaccgccaagctc
tcttcacgcatcgatgacatcgacctgaacctggaagatttcgtgcagcgcgtgaacgcc
gacatcgtcaacaaggtggttaacctcgcctcacgcaacgccggctttatcagcaagcgt
ttcgacggcgtgctggccgctgagctggccgacccggcgctgtacaaaaccttcaccgac
gcggcggaaagcatcggcgaagcatgggacagccgcgagttcggtaaagccatccgcgaa
atcatggccctcgccgacgtggctaaccgctatgtcgatgagcaggcgccgtgggtggtg
gcgaaacaggaaggccgcgacgccgacctgcaggccatctgcaccatgggcctgaatatg
ttccgcgtgctgatgacctggctgaagccggtcctgccgcagctggccgcgcgtgcggaa
gcgttcctcaacagcgaactgagctgggacgccattcagcagccgctgctggcgcataag
gtcaatccgttcaaggcgctgtacaaccgtatcgagatgaagcaggttgaagccctggta
gaagcttctaaagaagaggtgaaagccaccgcggcgccggtcaccggtccgctggcggac
gatccgattcaggagaccatcacctttgacgatttcgccaaagtcgatctgcgcgtggcg
ctgattgaaaacgcggaattcgtcgagggctccgacaagctgctgcgcctgacgctggat
ctcggcggcgaaaaacgtaacgtcttctccggcatccgctccgcctatccggatccgcag
ccgctgattggccgcctgacggtgatggtcgccaacctggcgccgcgcaaaatgcgcttc
ggcatctccgagggcatggtgatggccgccggccctggcgggaaggatatcttcctgtta
agccctgacgacggcgccaagccgggtcagcaggtgaaatag

DBGET integrated database retrieval system