KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_02581Help
Entry
KPNJ2_02581       CDS       T03177                                 

Definition
(GenBank) Alcohol dehydrogenase
  KO
K13953  alcohol dehydrogenase, propanol-preferring [EC:1.1.1.1]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00010  Glycolysis / Gluconeogenesis
kps00071  Fatty acid degradation
kps00350  Tyrosine metabolism
kps00625  Chloroalkane and chloroalkene degradation
kps00626  Naphthalene degradation
kps01100  Metabolic pathways
kps01110  Biosynthesis of secondary metabolites
kps01120  Microbial metabolism in diverse environments
kps01130  Biosynthesis of antibiotics
kps01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    KPNJ2_02581
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KPNJ2_02581
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    KPNJ2_02581
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    KPNJ2_02581
   00626 Naphthalene degradation
    KPNJ2_02581
Enzymes [BR:kps01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     KPNJ2_02581
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 CoA_binding Methyltransf_25 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: AHM79361
UniProt: W8VGJ8
Position
complement(2518562..2519572)
Genome map
AA seq 336 aa AA seqDB search
MKAAVVTHDHQVNVTEKTLRPLEYGEALLKMECCGVCHTDLHVKNGDFGDKTGVILGHEG
IGVVQKVGPGVTSLKPGDRASVAWFFEGCGHCDYCNSGNETLCRSVKNAGYTVDGGMAEE
CIVTANYAVKVPDGLDSAAASSITCAGVTTYKAVKVSHIKPGQWIAIYGLGGLGNLALQY
AKNVFNAKVIAIDVNDGQLELAASMGADLTINSRNEDAAKVIQEKTGGAHAAVVTAVAKA
AFNSAVDAVRAGGRVVAVGLPPEAMSLDIPRLVLDGIEVVGSLVGTRQDLVEAFQFAAEG
KVVPKVTLRPLEDINAIFKEMEQGQIRGRMVIDLRS
NT seq 1011 nt NT seq  +upstreamnt  +downstreamnt
atgaaggcagctgttgttacccacgaccatcaggttaacgtcacggaaaaaacgctgcgc
ccgctggaatacggcgaagcgctgttgaaaatggaatgctgcggcgtgtgtcatactgac
ctgcacgtgaaaaacggcgattttggcgataaaaccggcgtcattctcggccatgaaggg
atcggggtggtacaaaaagtcggcccgggcgtcacctccctgaagccgggcgaccgcgcc
agcgtggcgtggttcttcgaaggctgcggccactgcgattactgtaacagcggcaacgag
acgctctgccgctcggtgaaaaacgccggctataccgtcgatggcggcatggcggaggag
tgcatcgtcaccgccaactacgcggtaaaagttccggacggcctcgactccgccgccgcc
agcagcatcacctgcgcgggcgtcaccacctacaaagcggtcaaggtctcccacatcaaa
ccgggccagtggatcgccatctacggcctcggcgggctgggtaacctggcgctgcagtat
gcgaagaatgtgtttaacgccaaagtgatcgctatcgacgtcaacgacggacagctggag
ctggcggcctcgatgggcgccgacctgaccatcaactcccgcaatgaagatgcggcgaaa
gtgattcaggaaaaaaccggcggcgcccacgctgcggtagtaaccgcggtggctaaagcg
gcctttaactcggcggtggatgccgttcgcgccggtggccgcgtggtcgcggtgggcctg
ccgccggaggcgatgagcctcgatattccgcgtctggtgctggacggcatcgaagtggtc
ggttcgctggtcggcacccgtcaggatctggtggaagcctttcagtttgccgccgaaggc
aaagtggtgccgaaagtcaccctgcgtccgctggaagatatcaacgctatcttcaaagag
atggagcaaggtcagatccgcggccgtatggttatcgatctgcgtagctaa

DBGET integrated database retrieval system