KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_02762Help
Entry
KPNJ2_02762       CDS       T03177                                 

Definition
(GenBank) Acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00071  Fatty acid degradation
kps00072  Synthesis and degradation of ketone bodies
kps00280  Valine, leucine and isoleucine degradation
kps00310  Lysine degradation
kps00362  Benzoate degradation
kps00380  Tryptophan metabolism
kps00620  Pyruvate metabolism
kps00630  Glyoxylate and dicarboxylate metabolism
kps00640  Propanoate metabolism
kps00650  Butanoate metabolism
kps00900  Terpenoid backbone biosynthesis
kps01100  Metabolic pathways
kps01110  Biosynthesis of secondary metabolites
kps01120  Microbial metabolism in diverse environments
kps01130  Biosynthesis of antibiotics
kps01200  Carbon metabolism
kps01212  Fatty acid metabolism
kps02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPNJ2_02762
   00630 Glyoxylate and dicarboxylate metabolism
    KPNJ2_02762
   00640 Propanoate metabolism
    KPNJ2_02762
   00650 Butanoate metabolism
    KPNJ2_02762
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KPNJ2_02762
   00072 Synthesis and degradation of ketone bodies
    KPNJ2_02762
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPNJ2_02762
   00310 Lysine degradation
    KPNJ2_02762
   00380 Tryptophan metabolism
    KPNJ2_02762
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPNJ2_02762
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPNJ2_02762
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPNJ2_02762
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kps04147]
    KPNJ2_02762
Enzymes [BR:kps01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPNJ2_02762
Exosome [BR:kps04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPNJ2_02762
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HemY_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AHM79542
UniProt: W8V011
Position
2688288..2689478
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVIVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAIARAGIAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVVACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLISILTWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEGRFREQILALEVPDGKKATRLFATDEHPRNTPREKLATLRPAFKAD
GVVTAANSSGINDGAAALVMMTRQQAEKRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNIDVQSIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctaatgatattgtgattgtcagcggcgtccgtaccgctattggcacgttt
aacggcagtcttaaacatacccatcagcatgaccttggggccgccgtcattcgcgaagcg
atcgcccgcgccgggattgcgccgcaggatatcgacgaaacgatcgttggcaacgtcggg
caaatcgccgaaagcggttttatcgcccgcatctgtcagctgcgcgcggggatcccgcag
gagagcaccgcctattccgttaaccgccagtgcggctccggacttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggccgaggtggtcgtcgcctgcggcactgaaaat
atgacccagctgccctactacctgcgtaaagcgcgcgatggctatcgcatgggccacggc
gagctggaagatggcctgatctccattctcacctggccggaaggcccttatcacaacggc
atcaccgcggaaaacgtcgcgcaacgcttcggtattacccgcgaagcgatggacgatttc
gcctggtcgagccagcagaaggcgctgaaggcgatcgcggaaggtcgctttcgcgagcag
atcctggcccttgaggtgccggacggcaaaaaagcgacccgcctgtttgcgaccgatgaa
cacccgcgcaacaccccgcgtgaaaagctcgccacgctgcgtccggcgtttaaagccgac
ggcgtggtgacggcggccaactcatcgggcattaacgacggcgcggcggcgctggtgatg
atgacccgccagcaggcggaaaaacgcggcttaaccccgcgcatgcgcattcgcggctgg
gcggtcgccggctgcggagcggagattatggggtttggtccctctcccgctacccgacgc
ctgatggaccgtctcaatatagatgtgcagtccattgatttaattgaactcaacgaggcc
ttcgccgctcaggcgctggcggtgatgaacgatctgcgtcttgacccggcccgcgttaac
gtcaacggcggcgcgatcgccctcggccacccggtaggcgccagcggtgcgattctgccg
gtcaaactgatgtatgaaatggcgcgcagcggcgcacgcactggtctggtcaccatgtgc
atcggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system