KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_04055Help
Entry
KPNJ2_04055       CDS       T03177                                 

Definition
(GenBank) hypothetical protein
  KO
K10679  nitroreductase / dihydropteridine reductase [EC:1.-.-.- 1.5.1.34]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00633  Nitrotoluene degradation
kps01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    KPNJ2_04055
Enzymes [BR:kps01000]
 1. Oxidoreductases
  1.5  Acting on the CH-NH group of donors
   1.5.1  With NAD+ or NADP+ as acceptor
    1.5.1.34  6,7-dihydropteridine reductase
     KPNJ2_04055
  1.-  
   1.-.-  
    1.-.-.-  
     KPNJ2_04055
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Nitroreductase TM1586_NiRdase
Motif
Other DBs
NCBI-ProteinID: AHM80835
UniProt: W8UP24
Position
3917039..3917692
Genome map
AA seq 217 aa AA seqDB search
MDIVSVALKRYSTKAFDATKKLTAGEAEQLKTLLQYSPSSTNSQPWHFIVASTDEGKARV
AKAASGTYVFNERKILDASHVVVFCAKTAMDDAWLQRVVDQEEADGRFATPDAKAANHKG
RTFFADMHRKELKDDDQWMAKQVYLNVGNFLLGVAAMGLDAVPIEGVDFAILDEEFDLKA
QGYTSLVVVRVGHHSVEDFNATLPKSRLPQSTTITEI
NT seq 654 nt NT seq  +upstreamnt  +downstreamnt
atggatatcgtatcggtcgctttgaagcgctattccaccaaggcctttgacgccacgaaa
aagctgactgccggggaagcggaacagctgaaaacgctgctgcagtacagcccgtctagc
accaactcccagccgtggcactttattgtcgccagcaccgatgaagggaaagctcgcgtg
gcgaaagccgccagcggcacctacgtgttcaacgaacgtaaaattcttgacgcctcgcac
gtggtggtgttctgcgcgaaaaccgcgatggacgacgcctggctgcagcgcgtggtggat
caggaagaggccgatggccgtttcgccaccccggacgcaaaagccgctaaccacaagggt
cgcactttctttgccgatatgcaccgcaaagagctgaaagatgacgatcagtggatggca
aagcaggtgtatctcaacgtcggcaatttcctgctgggcgtagcggcgatgggtctcgac
gccgtgccgattgaaggggtcgattttgcgatcctcgatgaggaatttgacctgaaagcc
cagggctacaccagcctggtggtggtccgggtcggccaccatagcgtagaagatttcaac
gctaccctgccgaagtcgcgtctgccgcagtcgacgaccattaccgagatttaa

DBGET integrated database retrieval system