KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_04664Help
Entry
KPNJ2_04664       CDS       T03177                                 

Definition
(GenBank) Na+ transporting oxaloacetate decarboxylase alpha chain
  KO
K01571  oxaloacetate decarboxylase (Na+ extruding) subunit alpha [EC:7.2.4.2]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00620  Pyruvate metabolism
kps01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPNJ2_04664
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kps02000]
    KPNJ2_04664
Enzymes [BR:kps01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.4  Linked to decarboxylation
    7.2.4.2  oxaloacetate decarboxylase (Na+ extruding)
     KPNJ2_04664
Transporters [BR:kps02000]
 Other transporters
  Primary active transporters [TC:3]
   KPNJ2_04664
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HMGL-like PYC_OADA Biotin_lipoyl Biotin_lipoyl_2 HlyD_3 HlyD_D23 Peptidase_M23 FliO
Motif
Other DBs
NCBI-ProteinID: AHM81440
UniProt: W8UQU4
Position
4518122..4519906
Genome map
AA seq 594 aa AA seqDB search
MTVAITDVVLRDAHQSLFATRLRLDDMLPVAAQLDDVGYRSLECWGGATFDACIRFLGED
PWVRLRELKKAMPKTPLQMLLRGQNLLGYRHYADDVVERFVERAVKNGMDVFRVFDAMND
PRNMQPALQAVRRHGAHAQGTLSYTTSPAHTLQTWLDLTEQLLETGVDSVAIKDMSGILT
PHAAFELVSEIKKRYDVTLHLHCHATTGMAEMALLKAIEAGVDGVDTAISSMSATYGHPA
TEALVATLAGTPYDTGLDIHRLESIAAYFREVRKKYHAFEGQLKGTDSRILVAQVPGGML
TNLEGQLKQQSAAHRLDEVLAEIPRVREDLGFIPLVTPTSQIVGTQAVLNVLGGERYKTI
AKETAGILKGEYGRTPAPVNAALQARVLDGADPVTCRPADLLKPELAQLEADVKRQAQEK
GITLAENAIDDVLTVALFPQPGLKFLENRHNPAAFEPVPQAEAAQPVAKAEKPAASGVYT
VEVEGKAFVVKVSDGGDVSQLTAAAPAPAPAPASAPAAAAPAGAGTPVTAPLAGTIWKVL
ASEGQTVAAGEVLLILEAMKMETEIRAAQAGTVRGIAVKAGDAVAVGDTLMTLA
NT seq 1785 nt NT seq  +upstreamnt  +downstreamnt
atgaccgttgccattaccgatgtcgtcctgcgcgacgcccaccagtccctgttcgccacc
cgtctgcgtctcgacgatatgctgcccgttgccgctcagctggacgacgtcggctaccgc
tcgctggagtgctggggcggcgccacctttgacgcctgcatccgcttcctcggcgaggac
ccgtgggtccgcctgcgcgagctgaaaaaggcgatgcccaagaccccgctgcagatgctg
ctccgcggccagaacctgctcggctaccgccactacgccgacgacgtggtggagcgcttc
gtcgagcgcgccgtcaaaaacggcatggacgtcttccgcgtcttcgatgccatgaacgac
ccgcgcaacatgcagcccgccctgcaggcggtccgccgccacggcgcccacgcccagggt
acgctttcgtacaccaccagcccggcgcacaccctgcagacctggctcgacctcaccgaa
cagctgctggagaccggcgttgactccgtcgccatcaaggacatgtccggcattctgacg
ccgcatgccgcctttgagctggtcagcgaaatcaagaagcgctatgacgtcaccctgcac
ctgcactgccacgccaccaccgggatggcggagatggcgctgctgaaggccattgaagcc
ggggtcgacggcgtggatacggcgatttcgtccatgagcgccacctatggccacccggcc
accgaagcgctggtggccaccctcgccggcacgccgtacgacaccggcctcgatatccac
aggctggagagcatcgccgcctacttccgcgaggtgcgcaaaaaataccacgccttcgaa
ggccagctgaagggcaccgacagccgtatcctcgtcgcccaggtgccgggcgggatgctc
accaaccttgaaggccagctgaagcagcagagcgccgcccaccgtctggatgaagtactg
gcggaaatcccccgcgtgcgcgaggacctcggcttcatcccgctggtgaccccgacctcg
cagattgtcggcacccaggcggtgctcaacgtgctgggcggcgagcgctacaaaaccatc
gcgaaggagaccgccggtatcctgaaaggcgagtacggccgcaccccggccccggtgaac
gccgccctgcaggcgcgggtgctcgacggcgccgacccggtgacctgccgcccggccgac
ctgctgaagccggagctggcgcagctggaagcggatgtgaaacgccaggcacaggagaag
ggcatcacgcttgccgaaaacgccatcgacgacgtgctcaccgtggcgctgttcccgcaa
cccggcctgaagttcctcgaaaaccgccacaacccggcggcctttgagccggtaccgcag
gcggaagccgcgcagccagtggcaaaagcagaaaaacctgccgcctccggcgtctacacc
gtggaggtggaaggcaaagcctttgtggtcaaagtcagcgacggcggtgacgtcagccag
ctgacggcggctgctccggctcctgctcctgctcctgcctctgcacccgccgctgccgcc
ccggccggcgccggtaccccggtgaccgccccgctggcgggcactatctggaaggtgctg
gccagcgaaggccagacggtggccgcaggcgaagtgctgctgattctggaagccatgaag
atggaaaccgaaatccgcgccgcgcaggccgggaccgtgcgcggtatcgcggtgaaagcc
ggtgacgcggtggcggtcggcgacaccctgatgactctggcgtaa

DBGET integrated database retrieval system