KEGG   Klebsiella pneumoniae 30684/NJST258_2: KPNJ2_05186Help
Entry
KPNJ2_05186       CDS       T03177                                 

Definition
(GenBank) PTS system, sorbose-specific IIB component
  KO
K02813  PTS system, sorbose-specific IIB component [EC:2.7.1.206]
Organism
kps  Klebsiella pneumoniae 30684/NJST258_2
Pathway
kps00051  Fructose and mannose metabolism
kps01100  Metabolic pathways
kps02060  Phosphotransferase system (PTS)
Brite
KEGG Orthology (KO) [BR:kps00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPNJ2_05186
 09130 Environmental Information Processing
  09131 Membrane transport
   02060 Phosphotransferase system (PTS)
    KPNJ2_05186
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:kps02000]
    KPNJ2_05186
Enzymes [BR:kps01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.206  protein-Npi-phosphohistidine---L-sorbose phosphotransferase
     KPNJ2_05186
Transporters [BR:kps02000]
 Phosphotransferase system (PTS)
  Enzyme II [TC:4.A]
   Sorbose-specific II component
    KPNJ2_05186
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PTSIIB_sorb
Motif
Other DBs
NCBI-ProteinID: AHM81958
UniProt: W8V1Z2
Structure
PDB: 

Position
5023534..5024028
Genome map
AA seq 164 aa AA seqDB search
MQITLARIDDRLIHGQVTTVWSKVANAQRIIICNDDVFNDEVRRTLLRQAAPPGMKVNVV
SLEKAVAVYHNPQYQDETVFYLFTNPHDVLTMVRQGVQIATLNIGGMAWRPGKKQLTKAV
SLDPQDIQAFRELDKLGVKLDLRVVASDPSVNILDKINETAFCE
NT seq 495 nt NT seq  +upstreamnt  +downstreamnt
atgcaaattaccctcgcccgtattgatgaccgactgattcatggccaggtcaccaccgtg
tggtcaaaagtcgccaacgcccagcggataattatctgcaatgacgatgtatttaacgat
gaggttcgccggaccctgttgcgccaggcggctccgccaggcatgaaggtaaacgttgtc
agtctggaaaaagcggttgcggtctatcataacccgcaatatcaggacgagaccgtcttt
tatttatttaccaatccacacgatgttttaacgatggtgcgccagggcgtgcagatcgcc
acgttaaatattggtggcatggcctggcgacccggtaaaaaacagctaaccaaagccgtt
tctttggatccgcaggatattcaggcattccgtgaactcgataaactgggcgtaaaactc
gatttacgcgtggtcgcatcagatccgtcagtcaatattctcgacaaaattaacgaaaca
gctttctgcgaataa

DBGET integrated database retrieval system