KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_0081Help
Entry
VK055_0081        CDS       T03418                                 

Gene name
zwf
Definition
(GenBank) glucose-6-phosphate dehydrogenase
  KO
K00036  glucose-6-phosphate 1-dehydrogenase [EC:1.1.1.49 1.1.1.363]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00030  Pentose phosphate pathway
kpt00480  Glutathione metabolism
kpt01100  Metabolic pathways
kpt01110  Biosynthesis of secondary metabolites
kpt01120  Microbial metabolism in diverse environments
kpt01130  Biosynthesis of antibiotics
kpt01200  Carbon metabolism
Module
kpt_M00004  Pentose phosphate pathway (Pentose phosphate cycle)
kpt_M00006  Pentose phosphate pathway, oxidative phase, glucose 6P => ribulose 5P
kpt_M00008  Entner-Doudoroff pathway, glucose-6P => glyceraldehyde-3P + pyruvate
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    VK055_0081 (zwf)
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    VK055_0081 (zwf)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpt04147]
    VK055_0081 (zwf)
Enzymes [BR:kpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.49  glucose-6-phosphate dehydrogenase (NADP+)
     VK055_0081 (zwf)
    1.1.1.363  glucose-6-phosphate dehydrogenase [NAD(P)+]
     VK055_0081 (zwf)
Exosome [BR:kpt04147]
 Exosomal proteins
  Exosomal proteins of breast cancer cells
   VK055_0081 (zwf)
  Exosomal proteins of colorectal cancer cells
   VK055_0081 (zwf)
  Exosomal proteins of bladder cancer cells
   VK055_0081 (zwf)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: G6PD_C G6PD_N GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: AIK78709
UniProt: A0A2X3HQF0
Position
74551..76026
Genome map
AA seq 491 aa AA seqDB search
MAVTQTAQACDLVIFGAKGDLARRKLLPSLYQLEKAGQIHADTRIIGVGRADWDKAAYTK
VVREALETFMKEKIDEGLWDTLSGRLEFCNLDVNDTSGFTRLGEMLDQKNRVTINYFAMP
PSTFGAICKGLGEAKLNAKPARVVMEKPLGTSLETSREINDQVGEFFEECQVYRIDHYLG
KETVLNLLALRFANSLFVNNWDCRTIDHVEITVAEEVGIEGRWGYFDQAGQMRDMIQNHL
LQILCMIAMSPPSDLSADSIRDEKVKVLKSLRRIDRSNVREKTVRGQYTAGFAQGKKVPG
YLEEEGANKTSNTETFVAIRVDIDNWRWAGVPFYLRTGKRLPTKCSEVVVYFKTPELNLF
KETWQELPQNKLTIRLQPDEGVDIQVLNKVPGLDHKHNLQITKLDLSYSETFNQTHLADA
YERLLLETMRGIQALFVRRDEVEEAWKWVDSITEAWAADRDAPKPYQAGTWGPVASVAMI
TRDGRSWNEFE
NT seq 1476 nt NT seq  +upstreamnt  +downstreamnt
atggcggtaacgcaaacggcccaggcatgcgacctggtcattttcggcgcgaagggcgac
ctggcgcggcgtaaattgttgccttccctgtatcagcttgaaaaggcgggccagatccac
gctgacaccagaatcattggcgtcggccgtgccgactgggataaagcggcttataccaaa
gtcgtgcgcgaagcgctggaaaccttcatgaaggaaaaaattgatgaaggtttgtgggat
accctgagcggacgcctggagttctgtaatcttgacgtcaatgacaccagcggcttcacc
cgcctgggtgagatgctggatcaaaagaaccgtgtcaccatcaactatttcgctatgccg
ccgagcacctttggcgcgatctgtaaagggctgggcgaagcgaagcttaatgccaagcct
gcgcgcgtggtcatggaaaaaccgctcggcacctcgctggaaacctcccgtgaaatcaac
gaccaggtcggcgagttttttgaagagtgtcaggtctaccgtatcgaccactatctcggt
aaagagacggtcctcaacctgctggcgctgcgcttcgccaactccctgttcgtcaataac
tgggactgccgcaccatcgatcacgtcgaaatcaccgtcgcggaagaggtgggtattgaa
gggcgctggggttacttcgaccaggccgggcagatgcgcgacatgatccagaaccacctg
ctgcagatcctgtgcatgattgccatgtcgccgccgtccgatctcagcgccgacagcatc
cgtgatgaaaaggtcaaggtgctgaaatccctgcgccgtattgaccgctccaacgtgcgc
gagaaaaccgttcgcggccagtataccgccggctttgcccagggcaaaaaagtgcctggc
tatctcgaagaggagggggccaacaagaccagcaacaccgaaaccttcgtggcgatccgc
gtcgatatcgataactggcgctgggctggcgtaccgttctatctgcgcaccggcaaacgt
ctgccgaccaaatgctcagaggtagtggtttacttcaaaaccccggaactgaatctgttt
aaagagacctggcaggagctgccgcagaacaagctgaccattcgcctgcagccggacgaa
ggggtagatatccaggtactgaacaaagtgccgggcctcgatcataaacataacctgcag
atcactaaactggatctgagctactccgaaaccttcaaccagacgcacctggccgatgcc
tatgaacgtctgctgctggaaaccatgcgtggcatccaggcgctgttcgttcgccgcgac
gaagtagaagaggcgtggaaatgggttgactccattaccgaagcctgggcagccgaccgc
gatgcgccgaaaccgtatcaggccgggacctggggaccggttgcgtcggtggccatgatc
actcgcgacggtcgttcatggaacgagttcgagtaa

DBGET integrated database retrieval system