KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_0789Help
Entry
VK055_0789        CDS       T03418                                 

Definition
(GenBank) acetyl-CoA C-acetyltransferase family protein
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00071  Fatty acid degradation
kpt00072  Synthesis and degradation of ketone bodies
kpt00280  Valine, leucine and isoleucine degradation
kpt00310  Lysine degradation
kpt00362  Benzoate degradation
kpt00380  Tryptophan metabolism
kpt00620  Pyruvate metabolism
kpt00630  Glyoxylate and dicarboxylate metabolism
kpt00640  Propanoate metabolism
kpt00650  Butanoate metabolism
kpt00900  Terpenoid backbone biosynthesis
kpt01100  Metabolic pathways
kpt01110  Biosynthesis of secondary metabolites
kpt01120  Microbial metabolism in diverse environments
kpt01130  Biosynthesis of antibiotics
kpt01200  Carbon metabolism
kpt01212  Fatty acid metabolism
kpt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VK055_0789
   00630 Glyoxylate and dicarboxylate metabolism
    VK055_0789
   00640 Propanoate metabolism
    VK055_0789
   00650 Butanoate metabolism
    VK055_0789
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VK055_0789
   00072 Synthesis and degradation of ketone bodies
    VK055_0789
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VK055_0789
   00310 Lysine degradation
    VK055_0789
   00380 Tryptophan metabolism
    VK055_0789
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VK055_0789
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VK055_0789
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VK055_0789
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpt04147]
    VK055_0789
Enzymes [BR:kpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VK055_0789
Exosome [BR:kpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VK055_0789
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt HemY_N ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIK79412
UniProt: A0A2D1HKJ9
Position
790895..792085
Genome map
AA seq 396 aa AA seqDB search
MTQANDIVIVSGVRTAIGTFNGSLKHTHQHDLGAAVIREAIARAGIAPQDIDETIVGNVG
QIAESGFIARICQLRAGIPQESTAYSVNRQCGSGLQALADGMMQLQSGQAEVVVACGTEN
MTQLPYYLRKARDGYRMGHGELEDGLISILTWPEGPYHNGITAENVAQRFGITREAMDDF
AWSSQQKALKAIAEGRFREQILALEVPDGKKATRLFATDEHPRDTPREKLATLRPAFKAD
GVVTAANSSGINDGAAALVMMTRQQAEKRGLTPRMRIRGWAVAGCGAEIMGFGPSPATRR
LMDRLNIDVQSIDLIELNEAFAAQALAVMNDLRLDPARVNVNGGAIALGHPVGASGAILP
VKLMYEMARSGARTGLVTMCIGGGQGISMLFEREGA
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atgacccaggctaatgatattgtgattgtcagcggcgtccgtaccgctattggcacgttt
aacggcagtcttaaacatacccatcagcatgaccttggggccgccgtcattcgcgaagcg
atcgcccgcgccgggattgcgccgcaggatatcgacgaaacgatcgtcggcaacgtcggg
caaatcgccgaaagcggttttatcgcccgcatctgtcagctgcgcgcggggatcccgcag
gagagcaccgcctattccgttaaccgccagtgcggctccggacttcaggccctggcggac
ggcatgatgcagctgcaaagcggccaggccgaggtggtcgtcgcctgcggcactgaaaat
atgacccagctgccctactacctgcgtaaagcgcgcgatggctatcgcatgggccacggc
gagctggaagatggcctgatctccattctcacctggccggaaggcccttatcacaacggc
atcaccgcggaaaacgtcgcgcaacgcttcggtattacccgcgaagcgatggacgatttc
gcctggtcgagccagcagaaggcgctgaaggcgatcgcggagggtcgctttcgcgagcag
atcctggcccttgaggtgccggacggcaaaaaagcgacccgcctgtttgcgaccgatgaa
cacccgcgcgacaccccgcgtgaaaagctcgccacgctgcgtccggcgtttaaagccgac
ggcgtggtgacggcggccaactcatcgggcattaacgacggcgcggcggcgctggtgatg
atgacccgccagcaggcggaaaaacgcggcttaaccccgcgcatgcgtattcgcggttgg
gcggtcgccggctgcggggcggagattatggggtttggtccctctcccgctacccgacgc
ctgatggaccgtctcaatatagatgtgcagtccattgatttaattgaactcaatgaggcc
ttcgccgctcaggcgctggcggtgatgaacgatctgcgtctcgacccggcccgcgttaac
gtcaacggcggcgcgatcgccctcggccacccggtaggcgccagcggtgcgatcctgccg
gtcaaactgatgtatgaaatggcgcgcagcggcgcacgcactggtctggtcaccatgtgc
atcggcggcggccaggggatttctatgctgttcgagcgcgaaggcgcttag

DBGET integrated database retrieval system