KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_3200Help
Entry
VK055_3200        CDS       T03418                                 

Definition
(GenBank) PPIC-type PPIASE domain protein
  KO
K03769  peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:kpt03110]
    VK055_3200
Enzymes [BR:kpt01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     VK055_3200
Chaperones and folding catalysts [BR:kpt03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    VK055_3200
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-ProteinID: AIK81768
UniProt: A0A2X3GSV7
Position
3281589..3281870
Genome map
AA seq 93 aa AA seqDB search
MAKSAAALHILVKEEKLALEILAKLERGVSFDHLAKRYSKCPSGRNGGDLGEFQQGAMVG
PFDQAVFSCPLLKPYGPVKTKFGYHIIKVLYRR
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggcaaaaagcgcagcggccctgcatatcctggtcaaagaagagaaactggcgctggag
atcctcgccaaactggagcggggcgtcagcttcgatcatctggcgaaacgctattctaaa
tgtccgtctggccgcaacggcggcgacttaggcgagtttcagcaaggcgcgatggtcggt
ccgtttgatcaagccgtcttcagctgtccgctgctcaaaccctatggcccggtgaaaacc
aaattcggctaccacatcatcaaggtgctgtatcgccgctag

DBGET integrated database retrieval system