KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_3271Help
Entry
VK055_3271        CDS       T03418                                 

Gene name
fucO2
Definition
(GenBank) lactaldehyde reductase
  KO
K00001  alcohol dehydrogenase [EC:1.1.1.1]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00010  Glycolysis / Gluconeogenesis
kpt00071  Fatty acid degradation
kpt00350  Tyrosine metabolism
kpt00625  Chloroalkane and chloroalkene degradation
kpt00626  Naphthalene degradation
kpt01100  Metabolic pathways
kpt01110  Biosynthesis of secondary metabolites
kpt01120  Microbial metabolism in diverse environments
kpt01220  Degradation of aromatic compounds
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    VK055_3271 (fucO2)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VK055_3271 (fucO2)
  09105 Amino acid metabolism
   00350 Tyrosine metabolism
    VK055_3271 (fucO2)
  09111 Xenobiotics biodegradation and metabolism
   00625 Chloroalkane and chloroalkene degradation
    VK055_3271 (fucO2)
   00626 Naphthalene degradation
    VK055_3271 (fucO2)
Enzymes [BR:kpt01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.1  alcohol dehydrogenase
     VK055_3271 (fucO2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Fe-ADH Fe-ADH_2
Motif
Other DBs
NCBI-ProteinID: AIK81832
UniProt: A0A3N0PEQ8
Position
3357102..3358250
Genome map
AA seq 382 aa AA seqDB search
MSFMLALPKISLHGAGAIGDMVKLVAGKQWGKALIVTDGQLVKLGLLDSLFAALDEQQMA
YQLFDEVFPNPTEALVQQGYAAYQAARCDYLIAFGGGSPIDTAKAIKILTANPGPSTAYS
GVGKVKNAGVPLVAINTTAGTAAEMTSNAVIIDSERQVKEVIIDPNLIPDIAVDDASVML
DIPPAVTAATGMDALTHAIEAFVSVGAHPLTDANALEAIRLINLWLPKAVDDGHDLQARE
QMAFGQYLAGMAFNSAGLGLVHALAHQPGATHNLPHGVCNAILLPIIENFNRPNAVARFA
RVAQAMGVDTRGMSDEAASMEAINAIRTLSKRVGIPQGFSQLGVSKADIEGWLDKALADP
CAPCNPRPASRDEVRELYLEAL
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgagttttatgttggcactacctaaaatcagcctccacggcgcaggcgcgatcggtgat
atggtcaagctggtagcgggcaaacagtggggcaaggcgctgatcgtcaccgacggtcag
ctggtgaagctgggcctgctggacagcctgttcgccgcgctggatgaacagcagatggct
tatcagctatttgacgaggtattccccaaccccaccgaagcgctggtgcagcaaggctat
gcggcttaccaggcggcccgctgcgattacctgatcgccttcggcggcggtagcccgatt
gataccgccaaagcgataaaaatcctcaccgccaacccaggcccctccaccgcctactcc
ggcgtcggcaaagtgaaaaacgctggcgtgccgctggtggccatcaacaccaccgccggc
acggcggcggagatgaccagcaacgcggtaattatcgatagcgagcggcaggtgaaagag
gtgattatcgacccgaacctgatcccggatatcgccgttgacgacgccagcgtgatgctc
gacattccgccagccgttaccgccgccaccggcatggatgccctgacccacgccatcgag
gcctttgtctccgttggcgcccatccgctgaccgacgccaacgccctcgaagccattcgt
ctgattaacctgtggctgccgaaagcggtagacgatgggcacgatctgcaggcccgcgag
cagatggcctttggccagtatctggcgggcatggcgttcaacagcgccggtctcgggctg
gtacatgccctggcccatcagcctggcgccacccataatctgccgcacggggtatgcaac
gccatcctgctgccgatcatcgaaaactttaaccgcccgaacgcggtggcgcgctttgcc
cgcgtggcgcaggcgatgggcgtcgatactcgcggcatgagcgatgaagctgccagcatg
gaggccatcaatgccatccgcacgctgagcaaacgcgtagggatcccccagggtttcagc
cagcttggcgtcagcaaagccgatatcgaaggctggctggataaagcgctggccgaccca
tgcgcgccgtgtaacccgcgccccgccagccgcgatgaggttcgcgagctctatctggag
gccttatga

DBGET integrated database retrieval system