KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_4263Help
Entry
VK055_4263        CDS       T03418                                 

Gene name
sacA
Definition
(GenBank) sucrose-6-phosphate hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00052  Galactose metabolism
kpt00500  Starch and sucrose metabolism
kpt01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00052 Galactose metabolism
    VK055_4263 (sacA)
   00500 Starch and sucrose metabolism
    VK055_4263 (sacA)
Enzymes [BR:kpt01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     VK055_4263 (sacA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: AIK82808
Position
4363169..4364605
Genome map
AA seq 478 aa AA seqDB search
MMTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHPYS
TQWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKFHG
DPGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDSWYMIVGAREG
DTGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAGFS
NRNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFSTPDGRRIVIGWLDMWESP
LPEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVDNC
EAMEVNLRWDCARSSAEQYGLRFGDGLRIYVDAQQQRLVLERHYPQYGLCGTRSVPLTAG
ADLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPRRELALFAWSGSAALTEAGAWQLE
NT seq 1437 nt NT seq  +upstreamnt  +downstreamnt
atgatgacttacacaatctcccgggctgaacaggtactccagacacaacgccaggcgctg
aatctgcgctggtatccgcactatcacctggcggcccgcgccgggtggatcaacgaccca
aacggtctggtgtggttcgacggctggtaccatgccttttatcaacatcacccgtactcc
acccagtgggggccgatgcactgggggcacgcgcgcagtaaggatctggtgcactgggag
catttgccggtagcccttgcgccggagggcccggaggataaagacggctgcttctccggc
tcggcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttccacggc
gatcctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgcgacggg
atccactttgagcgccaggggatggtggtcgacaccccgccgggtatgcaccacttccgt
gacccgaaggtctggcgtgaaggagacagctggtacatgatcgtcggcgcgcgcgaaggc
gataccggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggacgcgggg
gtgctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttcttcacc
ctcaacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcggggttcagc
aaccgtaatctgttccagagcggctatctgatcggcgagtggcagccaggccagcgtttt
attcgccatggcgaattccgggagatggataacggccacgatttctatgccccgcaaagc
ttctccacccccgatggccggcggatcgtgattggctggctggatatgtgggaatcgccg
ctgccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctgagcctg
agcgcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgcggcgcc
tggttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgacaactgc
gaggcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcagtatggt
ctgcgctttggcgatggcctgcgcatctacgtggatgcccaacagcagcgtctggtgctg
gaacggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgaccgccggg
gcggatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtcaatgac
ggcgaagcctgcctgagcagccgtatctatccgcaggctccccgccgtgaattagcgtta
tttgcctggagcggctcggcggcattaaccgaagccggcgcctggcagctcgaataa

DBGET integrated database retrieval system