KEGG   Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1: VK055_4877Help
Entry
VK055_4877        CDS       T03418                                 

Gene name
thlA
Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpt  Klebsiella pneumoniae subsp. pneumoniae ATCC 43816 KPPR1
Pathway
kpt00280  Valine, leucine and isoleucine degradation
kpt00310  Lysine degradation
kpt00362  Benzoate degradation
kpt00380  Tryptophan metabolism
kpt00620  Pyruvate metabolism
kpt00630  Glyoxylate and dicarboxylate metabolism
kpt00640  Propanoate metabolism
kpt00650  Butanoate metabolism
kpt00900  Terpenoid backbone biosynthesis
kpt01100  Metabolic pathways
kpt01110  Biosynthesis of secondary metabolites
kpt01120  Microbial metabolism in diverse environments
kpt01130  Biosynthesis of antibiotics
kpt01200  Carbon metabolism
kpt01212  Fatty acid metabolism
kpt02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpt00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    VK055_4877 (thlA)
   00630 Glyoxylate and dicarboxylate metabolism
    VK055_4877 (thlA)
   00640 Propanoate metabolism
    VK055_4877 (thlA)
   00650 Butanoate metabolism
    VK055_4877 (thlA)
  09103 Lipid metabolism
   00071 Fatty acid degradation
    VK055_4877 (thlA)
   00072 Synthesis and degradation of ketone bodies
    VK055_4877 (thlA)
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    VK055_4877 (thlA)
   00310 Lysine degradation
    VK055_4877 (thlA)
   00380 Tryptophan metabolism
    VK055_4877 (thlA)
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    VK055_4877 (thlA)
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    VK055_4877 (thlA)
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    VK055_4877 (thlA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpt04147]
    VK055_4877 (thlA)
Enzymes [BR:kpt01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     VK055_4877 (thlA)
Exosome [BR:kpt04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   VK055_4877 (thlA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N ketoacyl-synt ACP_syn_III
Motif
Other DBs
NCBI-ProteinID: AIK83404
Position
complement(5005017..5005739)
Genome map
AA seq 240 aa AA seqDB search
MKNCVIVSAARTAIGSFNGALATTSAIDLGATVIKAALQRAQLDPQRVDEVIMGNVLQAG
LGQNPARQALLKSGLAETVCGFTVNKVCGSGLKSVALAAQAILAGQAQALVAGGMENMSQ
APYLLDAKARWGYRLGDGRLSDVILRDGLICATHGYHMGITAENVAKEYGISREMQDELA
LLSQRKALAAIDSGAFRAEIVPVSVTVKKRPFLNVMSFLKPTLRQKGLPLCVRPSTSLAQ
NT seq 723 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaattgtgtcatcgtcagcgcggcgcgtaccgcaatcggcagttttaacggcgcg
ctggcgaccaccagcgccatcgacctcggcgctacggtaattaaggcagcccttcagcgc
gcgcagctcgatcctcagcgcgtggatgaagtgattatgggcaacgtcctacaggccggt
ctcgggcaaaacccggcccgccaggcgctgctcaaaagcggtcttgccgagacggtatgc
ggctttaccgttaacaaagtgtgcggctccggcctcaaaagcgtggcgctggccgcgcag
gcgattctggccggacaggcgcaagcgctggtcgcaggcggtatggaaaacatgagccag
gcgccgtacctgctggacgctaaagcccgctggggctaccgtctcggcgacgggcggctc
tccgacgtgatcctgcgcgacggtcttatctgcgccactcacggttatcatatggggatc
accgcagaaaacgttgctaaggaatacggcatcagccgggaaatgcaggatgagctggcg
ctgctttcacagcgtaaagcgcttgccgccatcgattccggcgcattccgggccgaaatt
gtgccggtcagcgtcaccgtaaaaaaacgaccatttttgaacgtgatgagtttcctaaag
ccgactctacgacagaagggcttgccgctttgcgtccggccttcgacaagtctggcacag
taa

DBGET integrated database retrieval system