KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_0027Help
Entry
KP1_0027          CDS       T00910                                 

Gene name
hemN
Definition
(GenBank) coproporphyrinogen III oxidase
  KO
K02495  oxygen-independent coproporphyrinogen III oxidase [EC:1.3.98.3]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu00860  Porphyrin and chlorophyll metabolism
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
Module
kpu_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KP1_0027 (hemN)
Enzymes [BR:kpu01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.98  With other, known, physiological acceptors
    1.3.98.3  coproporphyrinogen dehydrogenase
     KP1_0027 (hemN)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Radical_SAM HemN_C
Motif
Other DBs
NCBI-ProteinID: BAH60947
Position
30705..32078
Genome map
AA seq 457 aa AA seqDB search
MSEQIIDWDLALIQKYNYSGPRYTSYPTALEFSPQFGAAEFDAAVARYPQRPLSLYVHIP
FCHKLCYFCGCNKIVTRQQHKADQYLDVLEQEIIHRAPLFATRQVKQLHWGGGTPTYLNK
AQISRLMDLLRSHFHFSAEAEISIEVDPREIELDVLDHLRAEGFNRLSMGVQDFNKEVQR
LVNREQDEAFIFDLLNHAREIGFTSTNIDLIYGLPKQTPESFAFTLQKVAELNPDRLSVF
NYAHLPTLFAAQRKIKDADLPSAEQKLEILQETIGSLTTAGYQFIGMDHFARPDDELAVA
QRHGVLHRNFQGYTTQGDTDLLGMGVSAISMIGDSYAQNQKELKQYYQQVAEQGNALWRG
IALTRDDCLRRDVIKALICNFQLDIAAVEAQWDVDFASYFAEDLKLLAPLAHDGLVAVDD
KVIQVTAKGRLLIRNICMCFDAYLRQKARMQQFSRVI
NT seq 1374 nt NT seq  +upstreamnt  +downstreamnt
atgtctgagcagataatcgactgggatctggccctgatccagaaatataactattccggg
ccgcgctatacctcgtatcccaccgcgctggagttttcaccgcaatttggcgcggcggaa
ttcgatgccgctgtggcccgttacccacagcgtcccctgtcgctgtacgtgcatatcccg
ttttgccataagctgtgttatttctgcggctgcaataagatagtcacccgccagcagcat
aaggccgatcaatatctcgatgtccttgaacaggagatcatccaccgcgcgccgctgttt
gccactcgccaggtgaagcaactgcactgggggggcggcacgccaacttatctcaataag
gcgcaaatcagtcgcctgatggatctgttgcgcagccattttcatttcagcgcggaagcc
gagatctccattgaggtcgatccgcgtgagatcgagctggatgtcctcgatcatttacgc
gctgagggtttcaaccgcctgagtatgggcgtacaggacttcaataaagaggttcagcgt
ctggttaaccgtgagcaggacgaagcgttcatctttgatttgctcaaccatgcgcgggag
attggttttacctcgaccaatatcgacctcatttatggcctgccgaagcaaacgccggag
agcttcgcctttaccctgcaaaaggtcgccgagctcaatcctgaccgcctgagcgtgttt
aactatgcgcatctgcccacgctctttgccgctcagcggaagattaaagatgccgatctg
ccctccgctgagcagaagctggagatcctgcaggaaaccatcggctcgctgacgacggca
ggctatcagtttatcggcatggaccatttcgcccgtcccgatgatgaattagcggtcgcg
caacgtcacggcgtactgcatcgtaatttccagggctacaccactcagggcgataccgat
ctgctggggatgggcgtttcggcgatcagcatgattggcgacagctacgcccagaaccaa
aaagagctcaagcagtactaccagcaggtagcagagcaagggaacgccctgtggcgcggg
atcgcgttaactcgcgatgactgtctgcgtcgcgacgtgattaaagcgttgatctgtaac
ttccagctggatatcgcggcggtcgaggcgcagtgggatgtggattttgcgtcttatttc
gccgaggatctgaagctgctggcgccgctggcgcatgacgggctggtggctgtggatgat
aaggtcattcaggtgacggcgaaaggccgcctgctgatccgcaacatctgtatgtgcttt
gatgcctacctacggcaaaaggcccgaatgcagcagttctcacgggttatttaa

DBGET integrated database retrieval system