KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_0136Help
Entry
KP1_0136          CDS       T00910                                 

Gene name
ppiC
Definition
(GenBank) peptidyl-prolyl cis-trans isomerase C
  KO
K03769  peptidyl-prolyl cis-trans isomerase C [EC:5.2.1.8]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:kpu03110]
    KP1_0136 (ppiC)
Enzymes [BR:kpu01000]
 5. Isomerases
  5.2  cis-trans-Isomerases
   5.2.1  cis-trans Isomerases (only sub-subclass identified to date)
    5.2.1.8  peptidylprolyl isomerase
     KP1_0136 (ppiC)
Chaperones and folding catalysts [BR:kpu03110]
 Protein folding catalysts
  Peptidyl prolyl isomerase
   Parvulin
    KP1_0136 (ppiC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Rotamase_3 Rotamase Rotamase_2
Motif
Other DBs
NCBI-ProteinID: BAH61045
Position
complement(138325..138606)
Genome map
AA seq 93 aa AA seqDB search
MAKTAAALHILVKEEKLALDLLEQLKNGADFGKLAKKHSICPSGKRGGDLGEFRQGQMVP
AFDKVVFSCPELEPTGPLHTQFGYHIIKVLYRK
NT seq 282 nt NT seq  +upstreamnt  +downstreamnt
atggctaaaaccgcggcagcactgcatatcctggtaaaagaagagaaactggcgctcgat
ctgctcgagcagctcaaaaacggcgccgatttcggcaagctggcaaagaaacactccatt
tgtccgtcaggcaaacgcggcggcgatctgggtgagttccgccagggccagatggtaccg
gccttcgataaagtggtcttctcctgccctgaactggagccaaccggcccgctgcatacc
cagttcggctaccacatcatcaaagtgctgtaccggaaataa

DBGET integrated database retrieval system