KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_0203Help
Entry
KP1_0203          CDS       T00910                                 

Gene name
fadB
Definition
(GenBank) 3-hydroxyacyl-CoA dehydrogenase/3-hydroxybutyryl-CoA epimerase/delta(3)-cis-delta(2)-trans-enoyl-CoA isomerase/enoyl-CoA hydratase
  KO
K01825  3-hydroxyacyl-CoA dehydrogenase / enoyl-CoA hydratase / 3-hydroxybutyryl-CoA epimerase / enoyl-CoA isomerase [EC:1.1.1.35 4.2.1.17 5.1.2.3 5.3.3.8]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00071  Fatty acid degradation
kpu00280  Valine, leucine and isoleucine degradation
kpu00281  Geraniol degradation
kpu00310  Lysine degradation
kpu00362  Benzoate degradation
kpu00380  Tryptophan metabolism
kpu00410  beta-Alanine metabolism
kpu00640  Propanoate metabolism
kpu00650  Butanoate metabolism
kpu00903  Limonene and pinene degradation
kpu00930  Caprolactam degradation
kpu01040  Biosynthesis of unsaturated fatty acids
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
kpu01120  Microbial metabolism in diverse environments
kpu01130  Biosynthesis of antibiotics
kpu01200  Carbon metabolism
kpu01212  Fatty acid metabolism
Module
kpu_M00087  beta-Oxidation
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Carbohydrate metabolism
   00640 Propanoate metabolism
    KP1_0203 (fadB)
   00650 Butanoate metabolism
    KP1_0203 (fadB)
  Lipid metabolism
   00071 Fatty acid degradation
    KP1_0203 (fadB)
   01040 Biosynthesis of unsaturated fatty acids
    KP1_0203 (fadB)
  Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KP1_0203 (fadB)
   00310 Lysine degradation
    KP1_0203 (fadB)
   00380 Tryptophan metabolism
    KP1_0203 (fadB)
  Metabolism of other amino acids
   00410 beta-Alanine metabolism
    KP1_0203 (fadB)
  Metabolism of terpenoids and polyketides
   00903 Limonene and pinene degradation
    KP1_0203 (fadB)
   00281 Geraniol degradation
    KP1_0203 (fadB)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KP1_0203 (fadB)
   00930 Caprolactam degradation
    KP1_0203 (fadB)
Enzymes [BR:kpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.35  3-hydroxyacyl-CoA dehydrogenase
     KP1_0203 (fadB)
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.17  enoyl-CoA hydratase
     KP1_0203 (fadB)
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.2  Acting on hydroxy acids and derivatives
    5.1.2.3  3-hydroxybutyryl-CoA epimerase
     KP1_0203 (fadB)
  5.3  Intramolecular oxidoreductases
   5.3.3  Transposing C=C bonds
    5.3.3.8  Delta3-Delta2-enoyl-CoA isomerase
     KP1_0203 (fadB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 3HCDH_N ECH_1 3HCDH ECH_2
Motif
Other DBs
NCBI-ProteinID: BAH61109
Position
complement(205469..207694)
Genome map
AA seq 741 aa AA seqDB search
MTRSYCWIQETDMLYKGDTLYLDWLEDGIAELVFDAPGSVNKLDTATVASLGHALDVLEK
QSDLKGLLLRSEKAAFIVGADITEFLSLFLVPEEQLSQWLHFANSVFNRLEDLPVPTISA
VNGYALGGGCECVLATDYRLATPDLRIGLPETKLGIMPGFGGSVRLPRLLGADSALEIIA
AGKDVGADQALKIGLVDGVVAAEKLRDGALAILRQAMNGDLDWKAKRQPKLEPLKLSKIE
AAMSFTIAKGMVAQTAGKHYPAPITAVKTIEAAARLGREEALVLENKSFVPLAHTNEARA
LVGIFLNDQYVKAKAKKLTKDVETPKHAAVLGAGIMGGGIAYQSAWKGVPVVMKDISDKS
LTLGMTEAAKLLNKQLERGKIDGLKLAGVISTIQPTLEYSGFDRVDVVVEAVVENPKVKK
AVLAETEAKVRPDTVLASNTSTIPISELASVLQRPENFCGMHFFNPVHRMPLVEVIRGEK
TSDNTIAKVVAWASKMGKTPIVVNDCPGFFVNRVLFPYFAGFSQLLRDGADFRKVDKVME
KQFGWPMGPAYLLDVVGIDTAHHAQAVMAAGFPQRMQKDYRDAIDALFDANRFGQKNGLG
FWRYKDDSKGKPKKEEDAAVDSLLADVSQSKRDFSDEEIIARMMIPMVNEVVRCLEEGII
ASPAEADMALVYGLGFPPFHGGAFRWLDTIGSAKYLDMAQQYQHLGPLYEVPAGLRDKAR
HNEAYYPQVEPARPVGALKTA
NT seq 2226 nt NT seq  +upstreamnt  +downstreamnt
atgaccagatcatattgctggattcaggagactgacatgctctacaaaggcgacaccctg
tacctcgactggctggaagatggcatcgccgaactggtgttcgatgccccaggttcggtc
aacaagcttgataccgcaaccgtagccagccttggtcatgcgctggacgtactggaaaaa
caaagcgatctcaaaggcctgctgctgcgctctgaaaaagcggcatttatcgtcggcgcg
gatatcaccgaattcctctcgctgttcctggtccctgaggagcagttaagccagtggctg
cattttgctaacagcgtcttcaatcgtctggaagatctccccgtccccacaatctctgcc
gtcaatggctatgcgctgggcggcggttgcgaatgtgtgctggcgaccgattaccgcctg
gcgacgccggatctgcgcattgggctgccggaaaccaagctcggcattatgcccggcttc
ggcggttccgtgcgtctgccgcgcctgctcggcgccgatagcgcgctggaaattattgcc
gccgggaaagacgtcggcgccgatcaagcactgaaaatcggcctggtggatggcgtggtc
gctgcggaaaaactacgcgacggcgcgctggcgatcctacgtcaggccatgaatggcgac
ctggactggaaagcgaaacgtcagccgaagctggagccgctgaagctcagcaaaattgaa
gccgccatgagcttcacgattgccaaaggcatggtcgcgcaaaccgccgggaagcattac
ccggcgccgatcaccgcggtcaaaaccattgaagccgccgcgcgtcttggtcgtgaagaa
gccctggtgctggaaaataaaagctttgtcccgctggcccataccaatgaggcccgcgcg
ctggttggtatcttcctgaacgaccagtacgtcaaagcgaaagcgaaaaagctgaccaaa
gatgtcgagacgccgaagcatgctgccgtcctgggcgctggcattatgggcggcggtatc
gcttaccagtcggcctggaagggcgtgccggtggtgatgaaagacatcagcgacaaatcg
ctgaccctgggcatgaccgaagcggcgaaactgctgaataaacagctggaacgcggcaaa
atcgacggtctgaagctggccggagtgattagcaccattcagccaaccctggaatacagc
ggttttgaccgcgtggacgtcgtcgttgaagcggtggtggaaaacccgaaagtgaagaaa
gccgtactagcggaaaccgaggcaaaagtgcgcccggataccgtgctggcgtccaacacc
tcaacgatccccatcagcgagctggccagcgttctgcagcgcccggaaaacttctgcggt
atgcacttctttaacccggtgcatcgcatgccgctggttgaagtgatccgcggcgaaaaa
acctcggataataccattgccaaagtggtggcctgggccagcaaaatgggcaaaacgccg
attgtggtgaatgattgtcccggcttcttcgtcaaccgggtactgttcccctacttcgcc
ggcttcagccagctgctgcgcgacggagcggacttccgcaaagtcgacaaagtgatggag
aaacagtttggctggccgatgggcccggcttatctactggacgtggtcggcatcgatacc
gcgcaccatgctcaggcggtcatggcggcgggcttcccgcagcggatgcagaaagattat
cgcgacgccatcgacgccctgtttgacgccaaccgtttcggccagaagaacggcctcggc
ttctggcgctataaagacgacagcaaaggtaagccgaagaaagaagaagatgctgccgtc
gacagcctgctggccgacgtcagccagtcgaagcgcgatttcagcgatgaagagattatc
gcccgcatgatgatcccgatggttaacgaagtcgtccgctgcctggaagaaggcattatc
gccagcccggcggaagcggatatggcgctggtatacggcctgggcttccctccgttccac
ggcggcgcattccgctggctggacaccatcggcagcgcgaagtatctcgatatggcacag
caataccagcaccttggcccgctgtatgaagtgccagccggtcttcgtgacaaagcgcgc
cataacgaagcgtattatccccaggtagagccagcccgtccggttggcgctctgaaaacg
gcttaa

DBGET integrated database retrieval system