KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_0593Help
Entry
KP1_0593          CDS       T00910                                 

Definition
(GenBank) putative membrane protein
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TraG_N PA-IL Ctr
Motif
Other DBs
NCBI-ProteinID: BAH61454
Position
complement(583723..585225)
Genome map
AA seq 500 aa AA seqDB search
MTANSYFEYVLTLLGWLVNNGVWQTLTATGLFALPLLAKLVALWLKARGQGADEGNVARL
LVVWVEHSLYSALLVILFAGVPFLSVDINTITYDSQRTKQCGWSVVQPGDSGYAPLINEL
SGQSASVPVWWYFTHALGKGITSAAVAVLPWKPDLRQLRFEVQHTLIADPALAQELQDFV
NDCYGPSRTRLKRLGSDISEEQSREVDWVGSSFYLSTPGYYDHDHSRSPRAAWPYDASRD
DGLSDTGGGGYPACKEWWSDGDAGLKNRLLKQVDTTLWQRLQKLGQSKEEYEEAVLRSLV
SPRNMQVSQGGLVYNGFGGSAGDNLSQTQLLSRVGGIIGTGLSSYALFPAFDNVRQALPM
VQAFLEMALVICIPVILLFSAWELKTVITLSVVQFALFFLTFWWELARWLDNWLMQMMYD
SDTHSYFNLWGLQNTSDDLIVNIIMGVMFLVLPAFWLGALTWAGVRIGTAVAGVMGSAVG
DIRSAGEQVGKMIVSKTRLP
NT seq 1503 nt NT seq  +upstreamnt  +downstreamnt
atgaccgccaacagctatttcgagtacgtgctcaccctgctcggctggctggtgaacaac
ggcgtgtggcagacgctgaccgccaccgggctattcgccctgcccctgctggcaaaactg
gttgccctgtggctgaaagcgcgcggccagggggcggatgaaggcaacgtcgcccgcctg
ctggtcgtctgggtggagcactcgctctacagcgccctgctggtgatcctcttcgcgggc
gtaccgttcctgagtgtcgatatcaataccattacatacgacagccagcgcacgaagcag
tgcggctggtcggtggtgcagcccggtgattccggctatgcgccgttgattaatgaactc
agcggccagagcgcctcggttccggtgtggtggtacttcactcatgcgctgggcaaaggc
atcactagcgccgccgtcgcggtattaccctggaaaccggacctgcgtcagctgcgtttt
gaagtgcagcacaccctgatcgccgatccagcgctggcgcaggaattacaggatttcgtt
aatgactgctacgggccgtcgcgcacacgcctcaagcggctgggcagcgatattagcgag
gaacagagccgggaggtggactgggtgggatcgtctttttatctctccacgccgggttat
tacgaccatgatcattcccgctcaccccgcgccgcctggccttatgacgccagccgcgac
gacggtctgagtgatacgggtggcggaggctatcctgcgtgtaaggagtggtggtccgat
ggcgatgcggggctgaaaaatcggctactgaagcaggtcgatacgacactctggcagcgg
ctgcaaaaactggggcagtctaaagaggagtatgaagaagcagtgctgcgctcgctggtg
agcccgcgcaacatgcaggtgtcgcagggcgggctggtgtacaacgggtttggcgggagt
gcgggggataatctcagccagacgcagttgctcagccgcgtcggcgggatcatcggcacg
gggctttccagctacgccctgtttccggcgtttgataacgtccgccaggcgctgccgatg
gtgcaggcgttcctcgaaatggcgctggtaatttgtataccggtaattctgctgttctcg
gcatgggagcttaaaacagtcatcacgctgagcgttgtgcagttcgctctgttctttctc
accttctggtgggaactggcccgctggctggataactggctgatgcagatgatgtacgac
agcgacacccactcgtatttcaacctctggggcctgcaaaacacctccgacgatctgatt
gtgaatatcattatgggcgtgatgttcctggtgcttccggcattctggctgggggcgctg
acctgggcgggcgtcaggatcggcacagcagtcgctggggtgatgggcagcgctgtcggt
gatatccgcagcgctggcgaacaggtcgggaaaatgatcgtcagtaaaacgcgtttaccg
tag

DBGET integrated database retrieval system