KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_0614
Entry
KP1_0614          CDS       T00910                                 

Definition
(GenBank) hypothetical protein
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
SSDB
Motif
Pfam: TraC_F_IV FtsK_SpoIIIE AAA_29 DUF87 T2SSE AAA_22 AAA_10 P-loop_TraG AIG1 AAA_19 AAA_7 AAA_16
Other DBs
NCBI-ProteinID: BAH61471
Position
complement(600518..603148)
AA seq 876 aa
MNERCGLPQQALNTSYRKGPSFVDWLPWVEFLPESQTLLLEDGRSVGAVFELIPVGTEGR
STAFLEQMRDTVTDALQDAFDEHERAPWVVQFFCQDEDDSEAWLASLSAYAAPEIRNSAF
TREWLTQMANHMANLTRDEGLFLDNTVTRTRWRATWRRTRMVVYRWLPGFSPDEPSPEET
LNNICERLTAGLKAAGINAIRQNEQAIHRWMVRWFNPAPPVEDKKAFWRQLDLPEAESLP
VITDFAERLLTSEPRSDAKNGVWWLDNRPHKVMVVDRLRKAPPPGLLTGETSRGDGINAL
FDLLPAGTIINLTVVVYPQDKLEQHISHLADRAIGDNTDSEYTRRDCHEVRSYLKDGHKL
YRSTLAFYLHAPDTDTLFRQQRQLHSLLLNAGLVPVQEQHEVAPLSHWLRWLPMCFDPLR
DLCGLYTRLNFVQHIAGLMPVYGRETGTGHPGICYFNRGGAPLCFDPLNKLDRAQNGHLL
LLGPTGAGKSATLNAKIAQLMALHRPRLFIIEAGNSFGLMADYAAAHGLTVNKINLRPGS
GVTLPLFADAWRLVEQAVTDAEPPEDEESDGDDQRDVLGEMEITARLMITGGEAKEDARL
TRPDRAMIRQAIIAAAHTCYQEKRQTLTQDIRDALFALSRDNSLPEARRQRAYEMAESIN
LFCAGFEGELFNREGQMWPETDITLVDLATFAREGYEAQLAISYISLINHINNLGERDQH
LVRPIVNITDEAHIITVNPLLARFLTKGSKMWRKLGIWLWLATQNLADFPDEAKKLLNMI
EWWELLVMPPEEIEQVCRFKALTEEQRQLLRSAVKSPGQYTEGVVLSPRVEALFRVVPPA
LYLALAMTEKHEKAERRRIMQETGCSEVEAAMKFKF
NT seq 2631 nt   +upstreamnt  +downstreamnt
atgaatgaacggtgcggtctcccgcaacaggcgctgaataccagctaccgcaagggcccg
tcctttgtcgactggctgccgtgggtggagtttttgccggagtcgcagacgctgctgctg
gaagatggccgctcggtgggcgcggtgtttgagctaatacctgttggcaccgaaggccgc
tcgacggcctttctcgaacagatgcgcgataccgtcaccgacgcattacaggatgccttt
gatgagcatgaacgtgcgccgtgggtggtgcagtttttctgccaggacgaggacgacagc
gaggcgtggctggcatcactttcagcttacgccgcaccggaaattcgcaactccgccttt
acccgcgaatggctcacgcagatggcaaaccatatggcgaatctcacccgcgatgagggg
ctgtttctcgataacaccgtcacccgtacccggtggcgggcgacgtggcggcgcacgcgg
atggtggtgtaccgctggcttccaggtttctcgccggacgaaccgtccccggaagagacg
ctgaacaatatctgcgagcgtctcaccgccgggctgaaagcggcgggaattaacgccatc
cgccagaatgaacaggccattcaccgctggatggtgcgctggtttaatcctgcgcctcca
gtggaagataaaaaagccttctggcgacaactggatttaccggaagctgaatctctgccc
gttatcaccgatttcgctgaacgactgctgacgagcgaaccgcgctcggacgcaaagaac
ggcgtttggtggttggataaccgaccgcataaagtgatggtggtcgaccgcctgcgcaaa
gcgccgccgcccggcctgctgaccggagaaacctcgcgcggcgacggcatcaatgccctg
ttcgacctgctgcctgcgggaaccatcataaacctgaccgtagtggtgtatccgcaggac
aagctggagcagcatatcagccacctcgccgaccgggcgattggcgacaacaccgattcg
gaatacacccgccgcgactgccacgaggtacgcagctatctcaaggacggccataagctc
taccgcagcacgctggcgttttacctgcatgcacccgacaccgataccctgtttcgccag
cagcgccagttgcacagcctgttgcttaacgccggtctggtacccgtacaggagcagcat
gaagtggcccccttaagccactggttacgctggctgccgatgtgtttcgatcccctgcgc
gatctgtgcgggctgtatacccggctcaacttcgttcagcatatcgccgggctgatgccg
gtgtacgggcgggaaaccggcaccgggcatccggggatttgttacttcaatcgcggcggc
gcgccgctgtgcttcgatccgctgaataagctagaccgcgcccagaacggccatctgctg
ttgctcggcccgaccggagcgggcaaatccgccacgctgaacgcgaaaatagcccaattg
atggcactgcaccgccctcgcctgtttatcatcgaagccgggaactcgttcggcctgatg
gcggactacgctgccgcccacggtctgacggtgaacaaaatcaacctgcgtcccggttcc
ggtgtcaccctgcccctgttcgccgatgcctggcgactggtggaacaggcggtcaccgac
gccgaaccaccggaagatgaagagagcgacggcgatgaccagcgtgacgtgctcggtgaa
atggagatcaccgcccggctgatgatcaccggtggcgaggcgaaagaagatgcacgcctc
acccggccagacagggcgatgatccgtcaggcgattatcgctgccgcacatacctgttat
caggaaaaacgccagacgctaacgcaggatatccgcgatgcactgttcgccctttcccgc
gacaacagcctgccggaagcccgccgccagcgggcgtatgaaatggcggagtccatcaac
ctgttctgcgccggatttgaaggcgaactgtttaaccgtgaaggccagatgtggccggag
acggatataactctggtcgatctcgccaccttcgcccgtgagggttacgaagcccagctt
gccatcagctatatctcgctgattaaccatatcaataacctcggcgaacgcgaccagcat
ctggtgcgacccatcgtcaatatcaccgatgaggcgcatatcatcactgttaatccctta
ttggcgcgctttctcaccaaaggctcgaagatgtggcgcaagctcggtatctggctgtgg
ctcgccacccagaacctggcagattttcctgatgaggcgaagaagctgctcaatatgatc
gagtggtgggaactgctggtgatgccgccggaagagatcgagcaggtctgccgatttaaa
gcgctgacggaagaacagcgccaactgctgcgctcagcggtaaaatcgccggggcagtat
accgagggcgtggtgctgtcgccgcgcgtggaggcgctgtttcgggtggtgccgccagcg
ctgtatctggcgctggccatgactgagaagcatgagaaggccgagcggaggcggattatg
caggagacggggtgtagtgaggtggaggcggctatgaaatttaagttctaa

DBGET integrated database retrieval system