KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_0616Help
Entry
KP1_0616          CDS       T00910                                 

Definition
(GenBank) conserved hypothetical protein
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TrbI DivIC CLN3
Motif
Other DBs
NCBI-ProteinID: BAH61473
Position
complement(603501..604796)
Genome map
AA seq 431 aa AA seqDB search
MMPRQSLLLKILLPVIVFLTVWLLLRPADKSTPEKSPSRTVAALTPQELRELGIDGDTPA
DTIATLVGQMKQYRRELQSIQSDNESQQAREKRLKAQQATLASELRGDMRRQQDQMRDGL
LKSQRGLLDKLDRLMAKRPDDIPPGLGLTPGELPADVQPDIRWLEPLDAPPPVDEKLLRV
PLKAADKPPPKPDVKVYTLPQNATLTGSVAMTALIGRVPLNGTVSDPYPFKLLIGEDNLT
ANGIELPDVAGAVVSGIASGDWTLSCVRGQITSMTFVFHDGTIRTVPQGGKSGNKQQEIG
WLSDNQGLPCIPGERKSNAKEYLTSQFLLAGSGAAAQAFANGESTTVVEDGSITSAVTGN
NGQYVLGQAIGGGLKETADWMKQHYGQMFDAVYVPPGHKVAVHLTEALAIDYEPEGRKVK
YQQASTPEGLE
NT seq 1296 nt NT seq  +upstreamnt  +downstreamnt
atgatgccgcgccagagtctcctgctgaaaatcctgctaccagtgattgtctttctcact
gtctggctactgctgcgcccggcagacaaaagcacgccggagaaatctccatcccgcacc
gtggctgccttaacgccgcaggaactgcgcgaactgggcattgacggcgacacgcccgcc
gataccatcgccacgctggtcggccagatgaagcagtatcgtcgggagcttcagtcaatc
cagagcgataacgaaagccagcaggcgcgcgagaagcgcctcaaagcacagcaggcgacg
ctggcatctgagttacgcggggatatgcgcagacagcaggaccagatgcgcgatggacta
ctaaaaagccagcgaggattgctggacaagctcgaccgcctgatggcgaaacgcccggac
gatatcccgcccggtctggggctgacgcccggcgaactgcctgccgatgtgcagccggat
atccgctggctggagccgctggatgcgcccccgcctgtggacgaaaagctgctgcgcgtc
cccctgaaagcggcggacaaaccgccgccgaaacctgacgtaaaagtctacaccctgccg
cagaacgccacgctgaccggatcggtggcgatgacggcgctgattggtcgcgttccgctt
aacggcaccgtcagcgatccctacccgttcaaattgctgattggcgaggacaacctcacc
gccaacggcattgaactgccggacgtggcgggcgcggtggtctccggtatcgcctccggc
gactggacgctctcttgcgtgcgcgggcaaatcacctcgatgacctttgtgtttcacgac
ggcaccatccgcaccgtcccgcagggcggcaaatccggcaacaaacagcaggagatcggc
tggctttcggataaccaggggctgccgtgtattcccggcgagcgtaagagcaacgcgaag
gaatacctgacctcgcagttcctgctggcgggatccggcgcggcggcgcaggctttcgcc
aatggtgaaagcaccaccgtggtggaggacggtagtatcaccagcgcggtgacgggcaac
aatggccagtacgtgctcggccaggccatcggcggcgggctgaaagaaacagccgactgg
atgaagcaacactacggccagatgttcgatgccgtgtacgtgccgccgggccataaggtg
gcggtgcatctgactgaagcactggcgattgattacgagccggaaggccgaaaagtgaaa
taccagcaggccagcacgccggagggactggaatga

DBGET integrated database retrieval system