KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_0626
Entry
KP1_0626          CDS       T00910                                 
Name
(GenBank) hypothetical protein
  KO
K12071  conjugal transfer pilus assembly protein TraD
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpu02044]
    KP1_0626
Secretion system [BR:kpu02044]
 Type IV secretion system
  Conjugal transfer pilus assembly protein
   KP1_0626
SSDB
Motif
Pfam: TraG-D_C TrwB_AAD_bind DUF87 IstB_IS21 AAA_22 nSTAND3
Other DBs
NCBI-ProteinID: BAH61482
Position
complement(615555..617573)
AA seq 672 aa
MSRYALEALLRPPVEFYSTVTAGCGALICLTQAPLLMLTLWQARLMASALMLLALRRGWQ
GWHIVRYHRNLLCLPRYALTSRKIPVSRQRLFLGKGFRWLPIHTQRLYDCLQPEAARWLR
PGGCYRLARHIEKRAEHTLPRLTRLLSADRWLNPVRPLPPVGGNPWLHGVELKECDVTLP
LSERPGHTLVLGTTRVGKTRLAELLATQDIRRGEVVIVFDPKGDADLLKRLWTEAQRAGR
GDRFILFHLAYPKISARYNAIGRFGRISEVASRLTGQLSGEGNSAAFREFAWRFVNIIAR
ALVALGQRPDYQLISRHVVNIDALFIDYARIVLPRHNARAWEVVAQLAERVNDKNTPRHM
LGRDPHVVALEQYLNAEKFYDPILDGLLSAVRYDKTYFDKIVASLLPLLEKLTTGTLAAL
LAPDYHDLDDARPILDWQQAIRQKAVVYVGLDALSDAVVAAAAGNSMFADLVSVAGHLYK
FGLNDGLPGNSEKPSPVNLHCDEFNELMGEEFIPLVNKGGGAGIQVTAYTQTLSDIQARI
GSAPKAGQVVGNFNNLIMLRVCETATAELLTKQLPQVEVRSRQVSSGVTDTPGGINSFSS
NTREQVVTRNVPLLDTAALIQLPKGQAFALLEGGQLWKIRLPLPVADKPCPLPESVAQLA
AWMQTRQQGQAE
NT seq 2019 nt   +upstreamnt  +downstreamnt
atgagccgctacgccctggaggcgctgctgcgcccacccgtggagttttacagcaccgtc
accgctggctgtggcgcattaatctgcctgacgcaggccccactgctgatgctgacgcta
tggcaggcccgcctgatggccagcgccctgatgctgctggccctccgacgcggctggcag
ggctggcacatcgtgcgctaccaccgcaacctcctgtgcctgccgcgctacgcgctcacc
agccggaaaatcccggtcagccgccagcggctgtttctcggtaaaggctttcgctggctg
cccatccacacccaacggctgtacgactgcctgcaaccggaagccgcacgctggctgcgc
cccggagggtgttatcgcctggcaaggcatatcgaaaaacgcgccgaacatactcttccc
cgtcttacccggctgctcagcgccgatcgctggctgaatccggtgcgcccactgccgccc
gttggcggcaatccgtggctgcacggggtggagctgaaagagtgcgacgtcaccctgccg
ctcagtgaacgccccggccacacgctggtgctcggcaccacccgcgtcggcaaaacccgg
ctggcggaactgcttgccactcaggacatccgccgtggtgaggtggtaatcgttttcgat
ccgaaaggcgacgcggatctactgaagcgtctgtggacagaggcgcagcgcgccggacgc
ggcgaccgctttatcctgttccatctggcctacccaaagatctccgcccgctacaacgcg
atagggcgctttggccgcatctcggaagtggcatcgcgcctcaccggacagctttccggc
gaaggtaactcggcagccttccgcgagttcgcctggcgctttgtcaacatcatcgcccgc
gccctggtggcgctcggacagcgccccgactatcagttaatttcccgccacgtggtcaat
atcgacgccctgtttatcgactatgcccgcatcgtgctgccgcgccacaacgctcgggcg
tgggaagtggtggcgcaactggcggagcgcgttaacgacaaaaacacgccgcgccatatg
ctgggacgcgatcctcacgtagtggcgctggaacagtacctcaacgcggagaaattctac
gatccgatcctcgacggtctgctctcggcggtgcgctatgacaaaacctacttcgacaag
attgtcgcttcgctgctgccgctgctggaaaagctgaccaccggtacgctcgccgccctg
ctcgccccggactaccacgatctggatgatgcacgcccgatcctcgactggcagcaggcg
atccgtcagaaagcagtggtgtatgtcggactggatgcgctgtctgatgcggtggttgct
gccgccgccggcaattccatgtttgccgacctggtgagcgttgccgggcatctctataaa
tttggcctcaatgatggactgcccggcaatagcgaaaaaccgtcgcctgtcaacctgcac
tgcgatgagtttaatgaactgatgggggaggagtttatcccgctggtcaacaagggtggc
ggcgcgggcattcaggtcaccgcctacacccagacgctgagtgatattcaggcccgcatc
ggcagcgcccccaaggcaggccaggtggtgggtaactttaataacctgattatgctgcgg
gtgtgcgaaaccgccaccgccgaactgctgacgaagcaactgccgcaggtggaagtgcgc
agccgtcaggttagctccggcgtcaccgacacgccgggcggcatcaacagcttcagcagc
aacacacgcgagcaggtagttacccgcaatgtaccgctgctggataccgccgcgctgatc
cagcttcccaaaggtcaggcttttgctctacttgagggtggacagttgtggaaaattcgt
ctgccactgcccgtggcggataaaccctgcccactaccggagtccgtcgcacaactggcg
gcctggatgcagacgcgccagcagggacaggcggaatga

DBGET integrated database retrieval system