KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_0627
Entry
KP1_0627          CDS       T00910                                 
Name
(GenBank) conserved hypothetical protein
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-ProteinID: BAH61483
Position
complement(617570..618088)
AA seq 172 aa
MARGPALILLLPCLALAQPLPEAYLRAAEHFRVPPELLWAVTQTESGANLNGRHLPWPWT
LNIKGTGYRYASREQACQALLAAIRRISPKRIDVGLGQINIGWHRAYFDSPCDALHPLQN
LSLTARLLRKRYDERPGSWLNAAARYHRPAGGAPAARYRKLVSRHLQRATPP
NT seq 519 nt   +upstreamnt  +downstreamnt
atggcgcgaggtccagccctgatcctgctgctgccctgcctggcgctggcacagcctctg
ccggaagcgtacctgcgcgccgcagagcatttccgcgtgccgccggagctactatgggcc
gtcacgcagaccgaaagcggcgcgaacctgaacggcagacatcttccgtggccgtggacg
ctcaatatcaaagggaccggctaccgctacgccagccgggagcaggcctgtcaggcgctg
ctggccgctatccgccgcatcagcccgaagcgcattgacgtggggctcgggcaaatcaat
atcggctggcaccgggcgtattttgactctccctgcgatgccttgcatccgctgcagaac
ctgtcgctcaccgcccgcctgctgcgtaagcgctacgatgaacgtcccggaagctggctc
aatgctgccgcccgttatcaccgtcctgctggcggcgcgcctgccgcacgctaccgcaag
ctggtcagccgccatctgcaacgggcaacaccgccatga

DBGET integrated database retrieval system