KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_0629Help
Entry
KP1_0629          CDS       T00910                                 

Definition
(GenBank) putative type IV pilus protein
  KO
K02487  type IV pili sensor histidine kinase and response regulator
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KP1_0629
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kpu02022]
    KP1_0629
   02035 Bacterial motility proteins [BR:kpu02035]
    KP1_0629
Two-component system [BR:kpu02022]
 CheA family
  ChpA-ChpB/PilGH [MD:M00507]
   KP1_0629
Bacterial motility proteins [BR:kpu02035]
 Pilus system
  Twitching motility proteins
   KP1_0629
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAH61485
Position
complement(618745..619452)
Genome map
AA seq 235 aa AA seqDB search
MPSYPARSFQSTVEDAMKRLLPALILSIFNAVAAASPDAPEVVRYDRYLLVSPSPQQPPL
EQLTALSIPPGFHPTVGEALQYLLRGSGWSLCLADARRAQLYGLPLPLSQYHTGPLRLKA
ALQLLASPAWRMTTDENRREVCFTSDRSLPPTVAYRHPVSLRPLGPLTAPFFFAGTVQRG
DIRLAVIVPPEAVYLHQVVWLRRGEQWHGWRLERFDERRAVFRHGKRQLTLKVPE
NT seq 708 nt NT seq  +upstreamnt  +downstreamnt
ttgccctcttatccagcacgctcctttcaaagcactgtggaggatgcgatgaaacgactg
ctgccagccctgatactgtccattttcaacgccgtggccgctgcctctccagacgcgcca
gaagtcgtccgctacgaccgctatctgctggtcagcccgtcaccgcaacagccgccactc
gaacagcttaccgccctgtccattccgcccggttttcacccgacggtaggggaagcgttg
cagtacctgctgcgtggcagcggctggtccttgtgtcttgccgatgcgcgccgggcgcag
ctttatggcctcccgttaccgttgagccagtaccacaccggcccgctgcgcctgaaggcc
gccctgcaactgctggcgagcccggcatggcggatgaccaccgacgaaaaccgccgtgaa
gtctgttttaccagcgaccgttccctccccccgacggtggcttaccgtcatcccgtgtcc
ctccgccctttggggccgttaacggccccgttttttttcgccgggaccgtacagcgcggt
gatatccgcctggcagtgattgtgccgcccgaagccgtttacctccatcaggtggtatgg
ctgcgcaggggagaacagtggcatggctggcgtctggagcggtttgatgagcgccgggca
gtgttccgtcacggcaagcgccagctaacgctgaaagtgccggagtaa

DBGET integrated database retrieval system