KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_0823Help
Entry
KP1_0823          CDS       T00910                                 

Gene name
thrC
Definition
(GenBank) threonine synthase
  KO
K01733  threonine synthase [EC:4.2.3.1]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00260  Glycine, serine and threonine metabolism
kpu00750  Vitamin B6 metabolism
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
kpu01120  Microbial metabolism in diverse environments
kpu01230  Biosynthesis of amino acids
Module
kpu_M00018  Threonine biosynthesis, aspartate => homoserine => threonine
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KP1_0823 (thrC)
  Metabolism of cofactors and vitamins
   00750 Vitamin B6 metabolism
    KP1_0823 (thrC)
Enzymes [BR:kpu01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.3  Acting on phosphates
    4.2.3.1  threonine synthase
     KP1_0823 (thrC)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_synth_N
Motif
Other DBs
NCBI-ProteinID: BAH61658
Position
801317..802597
Genome map
AA seq 426 aa AA seqDB search
MKLYNLKDHNEQVSFAQAVTQGLGKHQGLFFPHDLPEFSLTEIDDMLAQDFVTRSAKILS
AFIGDEIPQDVLQQRVRAAFAFPAPVSKVQEDVGCLELFHGPTLAFKDFGGRFMAQMLTH
IAGDKPVTILTATSGDTGAAVAHAFYGLPNVKVVILYPRGKISPLQEKLFCTLGGNIETV
AIDGDFDACQALVKQAFDDEELKATLGLNSANSINISRLLAQICYYFEAAAQLPQEARNQ
LVISVPSGNFGDLTAGLLAKSLGLPIKRFIAATNANDTVPRYLQGGEWAPKATQATLSNA
MDVSQPNNWPRVEELFRRKIWRLSELGYAAVDDETTKAAMRELKAIGYISEPHAAIAWRA
LRDQLQPGEYGLFLGTAHPAKFKESVEEILQETLPLPKELADRADLPLLSHNLPADFAAL
RKLMMG
NT seq 1281 nt NT seq  +upstreamnt  +downstreamnt
atgaaactgtataacttaaaagatcataacgagcaggtcagctttgcgcaggccgtcacc
cagggacttggcaagcatcagggcctgttctttccgcacgatctgccggaattcagcctg
actgaaatcgacgacatgctggcgcaggactttgtcacccgtagcgccaaaattctatcc
gcctttatcggcgatgagatcccgcaggatgtcctgcagcagcgggtgcgcgcggcgttt
gcgtttccggcgccggtaagcaaggttcaggaagatgtcggctgtctggagctgttccat
ggccctacgctggcgttcaaggatttcggcggccgctttatggcgcagatgctgacccac
atcgcaggcgataagccggtcaccatcctcaccgcgacctctggcgacaccggggcggcg
gtggcgcatgctttctacggcctgccgaacgtcaaggtagtgatcctctatccgcgcggc
aagatcagtccgctgcaggagaagctgttctgtaccctcggcggcaatattgaaaccgtg
gcgattgatggcgactttgatgcctgccaggcgctggtgaagcaggcgtttgacgatgaa
gagctgaaggcgacgctgggtctcaactcggctaactccatcaacatcagccgcctgctg
gcgcagatctgttactacttcgaagcggcggcgcagctgccgcaggaagcccgcaatcag
ctggtgatttccgtgccgagcggcaacttcggcgatctgaccgccggtctgctggctaag
tcgctggggctgccgatcaagcgctttatcgccgccaccaacgccaacgacaccgttccg
cgctatctgcagggcggcgagtgggcgccaaaagccacccaggcgacgctgtccaacgcc
atggacgtcagccagccgaacaactggccgcgcgttgaagagctgttccgccgtaaaatc
tggcgtctcagcgagctgggctatgccgcggtcgatgatgagaccaccaaagcagcgatg
cgcgagctgaaggccatcggctacatctctgaaccgcatgcggcgattgcctggcgcgcg
ctgcgcgatcagctgcagccgggagagtacggcctgttcctcggcaccgcccatccggcg
aagttcaaagagagcgtggaggagatcctgcaggagactctgccgctgccgaaggagctg
gccgaccgcgccgacctgccgctgctgtctcacaacctgccggcggatttcgccgcgctg
cgtaagctgatgatgggctaa

DBGET integrated database retrieval system