KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_1688Help
Entry
KP1_1688          CDS       T00910                                 

Gene name
sucB
Definition
(GenBank) dihydrolipoamide acetyltransferase
  KO
K00658  2-oxoglutarate dehydrogenase E2 component (dihydrolipoamide succinyltransferase) [EC:2.3.1.61]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00020  Citrate cycle (TCA cycle)
kpu00310  Lysine degradation
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
kpu01120  Microbial metabolism in diverse environments
kpu01130  Biosynthesis of antibiotics
kpu01200  Carbon metabolism
Module
kpu_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpu_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KP1_1688 (sucB)
  Amino acid metabolism
   00310 Lysine degradation
    KP1_1688 (sucB)
Enzymes [BR:kpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.61  dihydrolipoyllysine-residue succinyltransferase
     KP1_1688 (sucB)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding Rhamnogal_lyase
Motif
Other DBs
NCBI-ProteinID: BAH62431
Position
1633585..1634811
Genome map
AA seq 408 aa AA seqDB search
MSSVDILVPDLPESVADATVATWHKKPGDAVVRDEVLVEIETDKVVLEVPASADGILDAV
LEDEGATVLSRQILGRLREGNSAGKESSEKADAKASTPAQRQQASLEEQNNDALSPAIRR
LLAEHNLDPAAIKGTGVGGRLTREDVEKHLAKAPAPAEAKAPAAAPAAAPAPQLGHRSEK
RVPMTRLRKRVAERLLEAKNSTAMLTTFNEVNMKPIMDLRKQYGEAFEKRHGIRLGFMSF
YVKAVVEALKRYPEVNASIDGDDVVYHNYFDVSMAVSTPRGLVTPVLRDVDLLGMADIEK
NIKELAVKGRDGKLTVDDLTGGNFTITNGGVFGSLMSTPIINPPQSAILGMHAIKDRPMA
VNGKVEILPMMYLALSYDHRLIDGRESVGFLVAIKELLEDPTRLLLDV
NT seq 1227 nt NT seq  +upstreamnt  +downstreamnt
atgagtagcgtagatattctggttcccgacctgcctgagtccgtagctgacgcaaccgtc
gccacctggcacaaaaaaccgggcgacgcggtcgtccgtgacgaagttctggtcgaaatc
gaaactgacaaagtggtactggaagtaccggcatcagcggacggcattctggatgcagtg
ctggaagacgagggcgccaccgtcctgtctcgccagatccttggccgcctgcgcgaaggc
aacagcgcaggtaaagaaagcagcgagaaagccgatgcgaaagcgtccactccggcgcag
cgtcagcaggcctctctggaagagcagaacaacgacgcgctgagcccggcgatccgtcgt
ctgctggctgaacacaaccttgacccagcggccatcaaaggcactggcgtcggcggccgt
ctgacccgcgaagacgttgagaaacatctggcgaaagccccggcgccggcagaagccaaa
gcgccagccgccgccccggcagccgcgccggcgccgcagctgggccaccgttcggaaaaa
cgcgtcccgatgacccgtctgcgtaaacgcgtagccgaacgtctgctggaagcgaaaaac
tctaccgccatgctgacgacctttaacgaagtcaacatgaagcccatcatggatctgcgt
aagcagtacggtgaggcgttcgaaaaacgtcatggcatccgcctgggctttatgtccttc
tacgtgaaagcggtagtggaagcgctgaaacgctatccggaagtgaacgcttccatcgat
ggcgacgacgtggtgtaccacaactacttcgacgtcagcatggccgtatccactccgcgc
ggtctggtcaccccggttctgcgtgacgtcgacctgctgggcatggcggatatcgaaaag
aatatcaaagagctggcagtgaaaggccgcgacggcaagctgaccgtagacgacctgacc
ggcggtaacttcactattaccaacggcggcgtcttcggctccctgatgtccacgccgatc
atcaacccaccgcagagcgctattctgggtatgcatgccattaaagaccgtccgatggcg
gtcaatggcaaggtagagatcctgccgatgatgtacctggcgctctcctatgaccaccgt
ctgatcgacggacgtgaatcggtaggcttcctggtggcgattaaagagctgctggaagat
ccgacccgtctgctgctggacgtgtag

DBGET integrated database retrieval system