KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_2509Help
Entry
KP1_2509          CDS       T00910                                 

Gene name
aldA
Definition
(GenBank) NAD-linked aldehyde dehydrogenase A
  KO
K07248  lactaldehyde dehydrogenase / glycolaldehyde dehydrogenase [EC:1.2.1.22 1.2.1.21]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu00620  Pyruvate metabolism
kpu00630  Glyoxylate and dicarboxylate metabolism
kpu01100  Metabolic pathways
kpu01120  Microbial metabolism in diverse environments
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KP1_2509 (aldA)
   00630 Glyoxylate and dicarboxylate metabolism
    KP1_2509 (aldA)
Enzymes [BR:kpu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.21  glycolaldehyde dehydrogenase
     KP1_2509 (aldA)
    1.2.1.22  lactaldehyde dehydrogenase
     KP1_2509 (aldA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aldedh DUF1487
Motif
Other DBs
NCBI-ProteinID: BAH63183
Position
2413169..2414608
Genome map
AA seq 479 aa AA seqDB search
MTAPVQHPMYIDGQFVSGRGDGWIDVLNPATEALLSRIPDGTAEEARLAIDAAERAQPGW
EALPAIERAGWLRKIAAGIRQRADEIAGLIVAEGGKIQQLAAVEVAFTADYLDYMAEWAR
RYEGEIVQSDRPGENILVFKRALGVTTGILPWNFPFFLIARKLAPALITGNTIVIKPSEF
TPNNAIAFAEIVHQVGLPKGVFNLVLGRGETVGQELAGNPKVAMVSMTGSVAAGEKIMAA
AAKNITKVCLELGGKAPAIVMDDADLELAVKAVVDSRVINTGQVCNCVERVYVQQGIYDR
FVNRLGEAMKAVQFGDPATRDDIAMGPLINAAARDQVAGKVAKAVAQGARVALGGQPLEG
KGYFYPPTLLLDVRQEMDIIHEETFGPVLPVVAFSTLDEALAMANDSDYGLTSSIYTRDL
NVAMKAIKGLKFGETYINRENFEAMQGFHAGWRKSGIGGADGRHGLNEYLQTQVVYLQA
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgacagcacccgttcaacacccgatgtatattgatggccagttcgtttccggtcgcggc
gacggctggatcgacgtgcttaacccggcgaccgaagcgctgctgtcgcggatcccggac
gggactgccgaagaggcacggctggcgattgacgccgccgagcgcgcccagcccggctgg
gaagcgctgccggccattgagcgtgcgggctggctgcgcaaaattgccgccggtatccgc
cagcgtgccgacgagatcgccgggctgattgtcgctgaaggcggcaagatccagcagctg
gcggcggtggaggttgcgttcaccgcggactatctcgactatatggcagaatgggcgcgc
cgttacgaaggtgagatcgtgcagagcgatcgcccgggggagaatatccttgtctttaaa
cgcgcgctgggggtgaccaccgggatcctgccgtggaacttcccgttctttcttatcgcc
cgcaagctggcgccggccctgatcactggaaataccatcgtcattaagcccagcgaattt
acgcccaataatgccatcgcctttgccgagattgtccatcaggttgggttgccgaaaggg
gtctttaaccttgtgcttggccgcggagaaaccgttggccaggagctagccggcaatccg
aaggtggcgatggtcagcatgaccggcagcgtggcggcgggagaaaaaattatggccgct
gcggcgaaaaatatcaccaaagtgtgcctcgagctcggcggcaaagcgcctgccattgta
atggacgatgcggatctggagctggcggtgaaagcggtagtggactcgcgggtgattaac
accgggcaggtgtgtaactgcgtcgagcgggtctatgttcagcagggaatatacgaccgc
ttcgtcaaccgcctcggtgaggcgatgaaggccgtccagtttggcgacccggcgacgcga
gatgacatcgcgatggggccgctgatcaacgcggcggcgcgggaccaggtggcgggcaaa
gtggcgaaggcggtggcgcagggggcgcgggtggcgctgggcggtcagccgctggagggc
aaaggctatttttatccgccgaccctgctgctggatgtacgtcaggagatggacattatc
catgaggaaaccttcggtccggtgctgccggtggtggccttttcgaccctcgatgaggcg
ctggcgatggccaatgacagcgattatggcctgacctcctcaatctatacccgcgatctg
aacgtggcgatgaaagcgattaagggactgaagtttggcgaaacctatatcaaccgtgag
aactttgaggcgatgcaggggttccacgccggctggcgtaagtcggggatcggcggcgca
gatggccgccacggcctgaatgagtacctgcagacccaggtggtctatctgcaggcctga

DBGET integrated database retrieval system