KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_2847Help
Entry
KP1_2847          CDS       T00910                                 

Definition
(GenBank) putative ABC transporter
  KO
K03707  thiaminase (transcriptional activator TenA) [EC:3.5.99.2]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu00730  Thiamine metabolism
kpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00730 Thiamine metabolism
    KP1_2847
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:kpu03000]
    KP1_2847
Enzymes [BR:kpu01000]
 3. Hydrolases
  3.5  Acting on carbon-nitrogen bonds, other than peptide bonds
   3.5.99  In other compounds
    3.5.99.2  aminopyrimidine aminohydrolase
     KP1_2847
Transcription factors [BR:kpu03000]
 Prokaryotic type
  Other transcription factors
   Others
    KP1_2847
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TENA_THI-4
Motif
Other DBs
NCBI-ProteinID: BAH63499
Position
2715322..2716017
Genome map
AA seq 231 aa AA seqDB search
MIVPAFSQGLYGRLRQLAAADWQRYVAHPFVQQLADGTLAENAFRRYLTQDYLFLIHFAR
SYALLVSKLRTLPEMRAAAASMNAILNELPLHVGYCAQWGISEPEMAAQPEAPETLNYTR
YVLDIGHSGDALDLLVALMPCVAGYAEIGLGLLQHPATRLDDNPYASWIRNYGDEGYLQG
VSAALALLETVWQQRGSEARITELSEIFTTATRLEAQFWQMGLNATAETRA
NT seq 696 nt NT seq  +upstreamnt  +downstreamnt
gtgatcgttcccgcttttagccaaggtctttacggccgtttacgccagctggccgccgct
gactggcagcgctatgtggcgcatcctttcgtccagcaacttgccgatgggacgctggcg
gaaaacgcctttcgtcgctatctgacccaggattatctgtttctgattcactttgcccgc
agctacgcgctgctggtgagtaaactgcgcacgctgccggagatgcgggccgcggccgcc
tcgatgaatgccatcctcaacgaactgccgctgcacgtcggctactgtgcccagtggggg
attagcgaaccggagatggccgcccaacctgaagcccccgaaaccctcaactatacccgc
tatgtgctggatattggccactcgggtgacgcgctggatctgctggtcgccctgatgccc
tgcgtcgcgggctacgccgaaatcggtctcggcctgctgcagcatcccgccacccgactg
gacgataacccctacgcctcatggatccgcaactatggcgatgaaggctatctgcagggc
gtcagcgccgcgctggcgctgttggaaacggtgtggcagcagcgcgggagcgaggcgcga
atcactgagctgagcgagattttcaccaccgccacccgccttgaggcgcagttctggcag
atgggcctcaacgcgacggcggagacccgggcgtga

DBGET integrated database retrieval system