KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_3131Help
Entry
KP1_3131          CDS       T00910                                 

Definition
(GenBank) beta-ketothiolase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00071  Fatty acid degradation
kpu00072  Synthesis and degradation of ketone bodies
kpu00280  Valine, leucine and isoleucine degradation
kpu00310  Lysine degradation
kpu00362  Benzoate degradation
kpu00380  Tryptophan metabolism
kpu00620  Pyruvate metabolism
kpu00630  Glyoxylate and dicarboxylate metabolism
kpu00640  Propanoate metabolism
kpu00650  Butanoate metabolism
kpu00900  Terpenoid backbone biosynthesis
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
kpu01120  Microbial metabolism in diverse environments
kpu01130  Biosynthesis of antibiotics
kpu01200  Carbon metabolism
kpu01212  Fatty acid metabolism
kpu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KP1_3131
   00630 Glyoxylate and dicarboxylate metabolism
    KP1_3131
   00640 Propanoate metabolism
    KP1_3131
   00650 Butanoate metabolism
    KP1_3131
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KP1_3131
   00072 Synthesis and degradation of ketone bodies
    KP1_3131
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KP1_3131
   00310 Lysine degradation
    KP1_3131
   00380 Tryptophan metabolism
    KP1_3131
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KP1_3131
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KP1_3131
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KP1_3131
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpu04147]
    KP1_3131
Enzymes [BR:kpu01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KP1_3131
Exosome [BR:kpu04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KP1_3131
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: BAH63763
Position
2972581..2973762
Genome map
AA seq 393 aa AA seqDB search
MTDIAIVAAVRTPIGSFRGAFAPLSAVDLGAAVVRGLLERCQLPAAAVDELIFGQVLTAG
CGQNPARQTALRAGLPVDTPAVTVNLVCGSGLKAVQQAVQAIRCGDAGIVIAGGQESMSN
APYLMHGARDGLRFGHASLQDSMIQDGLWDAFNDYHMGITAENLADAFDISRERQDAFAA
SSQRKAAAAIAAGRFREELVPVSVPQGKKPPRVVTDDEQPRPETSEQQLAQLRPAFRPAD
GSVTAGNASSLNDGAAAVLLMRVDKARELGLPVLARIVSSAVAGVDPSVMGIGPVSACRQ
ALQRAGWTLDEVDLIEANEAFAVQALAVGQLLEWDSEKVNVNGGAIALGHPIGASGCRIL
VSLVHEMQRRGASKGLATLCVGGGQGIAMTLQR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgccattgttgctgccgtacgcaccccgataggcagctttcgcggcgcc
ttcgcccctctttccgccgtcgacctcggcgcggcggtggtgcgcggcctgcttgaacgc
tgccagctgcccgccgcagcggtcgacgaactaattttcggccaggtgctcaccgccggc
tgcgggcagaacccggcgcgccagaccgcgctgcgggccggcctgccggtcgacactccg
gcggtcaccgtcaatctggtgtgcggctccgggctgaaagcggttcagcaggcggtgcag
gcgatccgctgcggcgacgccgggatcgttatcgccggcggccaggagagcatgagcaat
gctccctatctgatgcatggcgcccgcgacggcctgcgtttcggccacgccagcctgcag
gacagcatgatccaggacggcctgtgggacgcctttaacgactaccacatgggcattacc
gccgagaacctcgccgacgccttcgacatcagccgcgagcgccaggacgccttcgccgcc
agctcccagcgcaaagcagcggccgctatcgccgccgggcgctttcgcgaggagctcgtt
ccggtcagcgtcccgcagggcaaaaagccgccgcgagtcgtgactgacgatgagcaaccc
cgcccggagaccagcgagcagcagttggcccagctgcgcccggcgtttcgcccggctgac
ggcagcgtcaccgccgggaatgcttcgtcgctgaacgacggcgcagcggcggtcctgctg
atgcgtgtcgataaagcgcgcgagcttgggctgccggtgctggcgcgcattgtcagctca
gcggtcgccggggtcgacccgtcggtgatgggcatcggcccggtgagcgcctgccgccag
gcgctgcagcgcgccggctggacgctggacgaggtggaccttatcgaagccaacgaggct
tttgccgtccaggcgctggccgtcggccagctgcttgaatgggacagcgagaaggtcaac
gtcaacggcggcgccatcgccctgggccatcccatcggcgcctccggctgccggatcctc
gtcagcctggtgcatgagatgcagcgccggggcgccagcaaagggctggccaccctgtgc
gtcggcggcggccagggcatcgccatgacccttcaacgttaa

DBGET integrated database retrieval system