KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_3213Help
Entry
KP1_3213          CDS       T00910                                 

Gene name
mhpF
Definition
(GenBank) acetaldehyde dehydrogenase
  KO
K04073  acetaldehyde dehydrogenase [EC:1.2.1.10]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00360  Phenylalanine metabolism
kpu00362  Benzoate degradation
kpu00620  Pyruvate metabolism
kpu00621  Dioxin degradation
kpu00622  Xylene degradation
kpu00650  Butanoate metabolism
kpu01100  Metabolic pathways
kpu01120  Microbial metabolism in diverse environments
kpu01220  Degradation of aromatic compounds
Module
kpu_M00545  Trans-cinnamate degradation, trans-cinnamate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Carbohydrate metabolism
   00620 Pyruvate metabolism
    KP1_3213 (mhpF)
   00650 Butanoate metabolism
    KP1_3213 (mhpF)
  Amino acid metabolism
   00360 Phenylalanine metabolism
    KP1_3213 (mhpF)
  Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KP1_3213 (mhpF)
   00622 Xylene degradation
    KP1_3213 (mhpF)
   00621 Dioxin degradation
    KP1_3213 (mhpF)
Enzymes [BR:kpu01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.10  acetaldehyde dehydrogenase (acetylating)
     KP1_3213 (mhpF)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: AcetDehyd-dimer Semialdhyde_dh F420_oxidored GFO_IDH_MocA 2-Hacid_dh_C Shikimate_DH
Motif
Other DBs
NCBI-ProteinID: BAH63835
Position
complement(3048471..3049421)
Genome map
AA seq 316 aa AA seqDB search
MRKRKVAIIGSGNIGTDLMIKILRHGQHLEMAVMVGIDPQSDGLARARRLGVATTHEGVG
GLMQMAEFADIDFVFDATSAGAHIKNDAALREAKPGIRVIDLTPAAIGPYCVPVVNLADN
LHQGNVNMVTCGGQATIPMVAAVSRVAKVHYAEIVASIASQSAGPGTRANIDEFTETTSQ
AIEKVGGAGKGKAIIVLNPAEPPLMMRDTVYILSELASQEAIAASIAEMAAAVQAYVPGY
RLKQQVQFEVIPEDRPVNLPGVGCFSGLKTAVYLEVEGAAHYLPAYAGNLDIMTSAALAT
AEQMAGAMHSAAGATA
NT seq 951 nt NT seq  +upstreamnt  +downstreamnt
atgcgtaaacgtaaagtcgccattatcggctccgggaatatcggcaccgatttaatgatt
aaaatcctgcgccacggccagcatctggagatggcggtgatggtcggcatcgacccgcag
tcggatggcctggcccgcgcccggcgcctgggcgttgcgaccactcacgaaggggtgggc
ggcctgatgcagatggcggaatttgccgacattgattttgtttttgacgccaccagcgcc
ggggcgcacatcaaaaacgatgccgcgctgcgcgaagcgaagccggggatccgcgttatc
gacctgacgccggcggcgattggcccgtactgcgtaccggtggtcaacctcgcggacaat
ctccatcagggcaacgtcaatatggtgacctgcggcgggcaggcgaccatcccgatggtc
gccgcggtctcgcgagtggcgaaggtgcattacgcggagattgtggcctcgatcgccagc
caatccgccgggccgggcacgcgggccaatattgacgaattcaccgaaaccacctcgcag
gcgattgaaaaagtcggcggcgcgggcaagggcaaagcgattattgtactgaaccctgcg
gagccgccgctgatgatgcgcgataccgtctacatcctgagcgagctggcgtcgcaggag
gcgattgccgcctcgatcgccgaaatggcggcggcagtgcaggcttacgtcccgggctac
cggctgaagcagcaggtgcagtttgaggttatccccgaggacaggccggtcaacctgccc
ggcgtcggctgtttttccggcctgaaaaccgcggtttacctcgaagtggaaggggcggcg
cactatctgccagcgtacgcgggcaacctcgatattatgacctcggcggcgctggcgacg
gcggagcaaatggccggggcaatgcacagcgcggcgggagcgacagcatga

DBGET integrated database retrieval system