KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_3369
Entry
KP1_3369          CDS       T00910                                 

Definition
(GenBank) hypothetical protein
  KO
K11896  type VI secretion system protein ImpG
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpu02044]
    KP1_3369
Secretion system [BR:kpu02044]
 Type VI secretion system
  Imp/Vas secretion system core components
   KP1_3369
SSDB
Motif
Pfam: T6SS_TssF
Other DBs
NCBI-ProteinID: BAH63979
Position
complement(3193880..3195643)
AA seq 587 aa
MDDLTLRYFDAEMRYLREAAKAFAQAHPDRAAMLDLDKAGTPDPYVERLFEGFAFSVGRL
REKIDDDLPELTEGLVSMLWPHYLRTIPSLSIVALTPTLPAMKIAETVPAGFEISSRPLG
PKNTVCRYRTTRDLTLNPLAIDEAMMTAEPDGRSALRLRFACSELAGWSQTDLRRLALYL
GEDAVTGSALHLWLTRRQAALYLRLPGQTERVSLDGYFSPGGFSEEDRLWPKGESAFSGY
QLLLEYFTFREKFMFVQLNGLENITLPAGISHFTLEVVFSEVWQSDLPVSASSLRLHCVP
VINLFTLEADPLTISGLESEYLLRPKRLQDGHTEIYSVDSVTGSGRTGEARYVPFTRFRH
QGGMMRRHAPERYYHTRVKRGVTGMHDTWLILGGQQWEADRELARETVSLRITGTNGQLP
RRALQSTLLDRCESISATPLTVRNLCRPTLPAYPPAEDRYHWRVMSHLGTRFLNMMSSAE
VLRGTLSLYNWREDELNNRRLDAILAVSHHRIQRFEQGFLLRGLDIEVTLDGSGFTGAGD
VHLFGDMLNRFFALYADMNQFNQLTLIVQPEGKCIRWKENHSLRLPG
NT seq 1764 nt   +upstreamnt  +downstreamnt
atggacgatttaaccctgcgatattttgacgctgaaatgcgctacctgcgcgaggcggca
aaagcgttcgcgcaggctcaccccgatcgggcggcgatgctggatctcgataaagccggt
acgccggacccttacgttgagcgcctgtttgaaggctttgccttttccgttggtcgcttg
cgcgaaaaaattgatgatgatctgccggagctgaccgaggggctggtcagcatgctgtgg
ccgcactatttgcgcaccattccgtcgttatcgatcgtggcgctgaccccaacgctgccg
gctatgaagatagcggaaacggtgcccgccgggtttgagattagctcccgcccactgggg
ccgaaaaataccgtgtgccggtaccgaaccacccgcgatctgacgcttaacccgctggcg
atagatgaggcgatgatgacggcggagccggatgggcgttcggccctgcgactacgattc
gcctgtagcgagctggctggctggtcgcagaccgatctccgccgcctggcgctgtacctg
ggggaagacgccgttaccggcagcgccctccatctgtggctgacccgacgccaggccgcg
ctgtacctgcgtctgccgggtcagacagagcgggtaagcctcgacggctatttttccccg
gggggattcagcgaggaggatcgtttatggccgaagggggagagcgctttcagcggctat
cagctgctgctcgagtatttcacctttcgcgaaaaatttatgttcgtgcagctaaatggc
ctggaaaacatcaccctgccggcggggatatcgcatttcacgcttgaggtggtgttcagc
gaggtctggcaaagtgatttacccgtcagcgcaagcagcctgcgcctgcactgtgtgccg
gtgattaacctgtttacccttgaggccgatccgttgaccatcagcgggctggagagcgaa
tacctcctgcgtccgaagcgcctgcaggacgggcataccgaaatctattctgtcgacagc
gtgaccggctccgggcgcaccggggaggcgcgctatgtgcctttcacccgctttcgtcac
cagggcgggatgatgcgtcgccatgctcctgagcgctactaccacacccgcgtaaaacgg
ggcgtaaccggcatgcacgatacctggcttatcctcggcggacagcaatgggaggctgac
cgggagctggcgcgggaaacggtctccttgcgcatcaccggcactaacggccagctgccg
cgccgggcgctacagagcacgctgctggatcgctgtgagtcgatatcagccacgccgctt
accgtccgcaatctctgtaggcccacgctgccggcctatcccccggcggaagaccgctac
cactggcgggtcatgagccatctgggcacccgttttctcaacatgatgagcagcgccgag
gtgctgcgcggcacgctgtcgctctacaactggcgggaggatgagctcaataatcgccgt
ctggacgccattctggcggtcagccatcaccgaattcagcgtttcgagcagggcttcctg
ctgcgcgggctggatatcgaagtgacgctcgacggtagcggatttaccggtgcgggcgat
gtccacctgtttggcgatatgctcaaccgctttttcgcactatatgccgatatgaatcag
ttcaaccagctgacgctcattgttcaacctgaagggaaatgtatccggtggaaagagaat
cacagtctgcgcctgcccggctga

DBGET integrated database retrieval system