KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_3626
Entry
KP1_3626          CDS       T00910                                 

Gene name
virB1
Definition
(GenBank) type IV secretory pathway VirB1 component
  KO
K03194  type IV secretion system protein VirB1
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu03070  Bacterial secretion system
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   03070 Bacterial secretion system
    KP1_3626 (virB1)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02044 Secretion system [BR:kpu02044]
    KP1_3626 (virB1)
Secretion system [BR:kpu02044]
 Type IV secretion system
  Conjugal DNA-protein transfer (VirB/D) protein
   KP1_3626 (virB1)
SSDB
Motif
Pfam: SLT
Other DBs
NCBI-ProteinID: BAH64212
Position
3449225..3449935
AA seq 236 aa
MLSTTAFLAIAMQCAASIHPSTAFDVARVESGFNPYAIAEIVPKAGPSFGDQHIISHLPA
SRGDAEQILRRLTAQDRRYSVGLMQITSTNFRHYGVSATELLDPCTNLSVFEHILRDCYR
RGGTLKRALSCYYSGNFSTGQQPETAFSGTSYIQRIGYPPGSSRYAVPGTREDKSSVAVP
LKTTPASDSSRHHEIWPGVVVRGVPAKLRQEKIFIAPFSAPSVRRSFSLSPREEEE
NT seq 711 nt   +upstreamnt  +downstreamnt
atgctttccaccacagcctttctggcgatagccatgcagtgcgccgccagcattcatccg
tccacggcattcgacgtggcacgggtggaatccggttttaacccttatgccatcgctgag
attgtcccgaaggccggcccctctttcggcgatcaacacattatttctcacctgccagcc
agccggggagatgcagagcagattctccgtcgcctgacagcacaggatcgccgttactct
gtcgggctgatgcaaatcaccagcaccaatttccgccattatggtgtgtccgccacagag
ctacttgatccctgtaccaatctgtccgtcttcgaacacattctcagagactgctaccgg
cgcggcggcacgctgaaaagggcgctgagttgttattattccggcaatttcagtaccggg
caacaacctgaaacggcgttttccggaacgagctatatccagcgaatcggttatccgccg
ggatcatcccgctatgcggtccccggaacccgtgaggacaaatcatcagttgccgttccc
ctgaaaaccacccctgccagtgactcatcccgtcaccacgagatctggcccggagtcgtc
gtccgtggcgtccctgcgaaactccgccaagaaaaaatcttcatcgcaccgttctccgcg
ccgtcagtgcgccggagtttctccctgtcaccccgtgaggaggaggaataa

DBGET integrated database retrieval system