KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_4001Help
Entry
KP1_4001          CDS       T00910                                 

Gene name
gltX
Definition
(GenBank) glutamyl-tRNA synthetase
  KO
K01885  glutamyl-tRNA synthetase [EC:6.1.1.17]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu00860  Porphyrin and chlorophyll metabolism
kpu00970  Aminoacyl-tRNA biosynthesis
kpu01100  Metabolic pathways
kpu01110  Biosynthesis of secondary metabolites
kpu01120  Microbial metabolism in diverse environments
Module
kpu_M00121  Heme biosynthesis, plants and bacteria, glutamate => heme
kpu_M00846  Siroheme biosynthesis, glutamate => siroheme
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    KP1_4001 (gltX)
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    KP1_4001 (gltX)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpu01007]
    KP1_4001 (gltX)
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:kpu03016]
    KP1_4001 (gltX)
  09183 Protein families: signaling and cellular processes
   02048 Prokaryotic defense system [BR:kpu02048]
    KP1_4001 (gltX)
Enzymes [BR:kpu01000]
 6. Ligases
  6.1  Forming carbon-oxygen bonds
   6.1.1  Ligases forming aminoacyl-tRNA and related compounds
    6.1.1.17  glutamate---tRNA ligase
     KP1_4001 (gltX)
Amino acid related enzymes [BR:kpu01007]
 Aminoacyl-tRNA synthetase
  Class I (A)
   KP1_4001 (gltX)
Transfer RNA biogenesis [BR:kpu03016]
 Eukaryotic Type
  Aminoacyl-tRNA synthetases (AARSs)
   Multi-aminoacyl-tRNA synthetase complex (MSC)
    KP1_4001 (gltX)
 Prokaryotic Type
   Other AARSs
    KP1_4001 (gltX)
Prokaryotic defense system [BR:kpu02048]
 Toxin-antitoxin system (TA system)
  Type II TA system
   Type II TA system related factors
    KP1_4001 (gltX)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: tRNA-synt_1c HTH_15
Motif
Other DBs
NCBI-ProteinID: BAH64548
Position
complement(3825778..3827196)
Genome map
AA seq 472 aa AA seqDB search
MKIKTRFAPSPTGYLHVGGARTALYSWLFARNHGGEFVLRIEDTDLERSTPEAIEAIMDG
MNWLNLQWDEGPYFQTKRFDRYNNVIDEMLEAGTAYKCYCSKERLEALREEQMAKGEKPR
YDGRCRHSHEHHADDEPCVVRFANPQEGSVIFDDQIRGPIEFSNQELDDLIIRRTDGSPT
YNFCVVVDDWDMAITHVIRGEDHINNTPRQINILKALNAPVPVYAHVSMINGDDGKKLSK
RHGAVSVMQYRDDGYLPEALLNYLVRLGWSHGDQEIFTREEMIEFFSLGAVSKSASAFNT
DKLLWLNHHYINTLPAEYVATHLQWHIEQENIDTRNGPQLAELVKLLGERCKTLKEMAQS
CRYFYEEFAEFDADAAKKHLRPVARQPLEVVRDKLAAISDWTAENVHHAIQATADELEVG
MGKVGMPLRVAVTGAGQSPALDVTVHAIGKSRSVDRINKALAFIAEREGQAS
NT seq 1419 nt NT seq  +upstreamnt  +downstreamnt
atgaaaatcaaaactcgcttcgcgccaagcccaaccggctatctgcacgttggcggtgcg
cgtactgctctctattcctggctttttgcccgtaaccacggcggtgagtttgtgctgcgt
attgaagacaccgatctcgaacgctccaccccggaagcaattgaagccatcatggatggc
atgaactggctgaatctgcaatgggacgaaggcccctatttccagaccaaacgtttcgat
cgttataacaacgtaatcgatgagatgctggaagccggtaccgcttacaaatgctattgc
tcgaaagaacgtctggaagcgctgcgcgaagagcagatggcgaagggtgagaagccgcgt
tacgatggccgctgccgccatagccacgagcaccatgctgacgatgagccgtgcgtcgtg
cgtttcgccaacccgcaggaaggttcggttatttttgacgatcagatccgcggacctatc
gagttcagcaaccaggaactggacgatctgatcattcgccgtaccgatggttccccgacc
tataacttctgcgtggtggtagatgactgggatatggcgatcactcacgtgatccgcggc
gaagatcatatcaacaacacgccgcgccagatcaatatcctcaaagcgctgaatgcgccg
gtgccggtttatgcgcacgtgtcgatgatcaacggcgatgacggtaaaaaactttccaag
cgccacggcgcagtgagcgtgatgcagtaccgcgacgacggctacctgccggaagcgcta
ctcaactatctggtgcgcctgggctggtctcatggcgatcaggagattttcactcgcgaa
gagatgattgagttcttctcgctgggcgcggtgagcaaatccgccagtgcctttaacacc
gataaactgctgtggttaaaccatcactatatcaataccctgccggcggaatatgtggca
acgcatctgcagtggcatatcgagcaggaaaatatcgacactcgcaacggcccgcagctg
gctgagctggtgaaactgctgggcgagcgttgcaagacgctgaaagagatggcccagagc
tgccgctacttctatgaagagttcgctgaattcgatgccgacgccgcgaaaaaacatctg
cgtccagtggcgcgtcagccgctggaagtggttcgcgataagctggcggcgattagcgac
tggacggcggaaaacgtccatcacgcgattcaggcaactgctgatgagctggaggtgggg
atgggtaaagtcggtatgccgctgcgcgtggcggttaccggggcagggcaatctcctgcg
ctagacgttactgtccatgctatcggtaaatcccgtagcgtagatcgtatcaataaagcg
ctggcttttatcgctgaacgcgaaggccaggcgtcctga

DBGET integrated database retrieval system