KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044: KP1_4536Help
Entry
KP1_4536          CDS       T00910                                 

Definition
(GenBank) putative family 32 glycoside hydrolase
  KO
K01193  beta-fructofuranosidase [EC:3.2.1.26]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044
Pathway
kpu00052  Galactose metabolism
kpu00500  Starch and sucrose metabolism
kpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpu00001]
 Metabolism
  Carbohydrate metabolism
   00052 Galactose metabolism
    KP1_4536
   00500 Starch and sucrose metabolism
    KP1_4536
Enzymes [BR:kpu01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.26  beta-fructofuranosidase
     KP1_4536
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_32N Glyco_hydro_32C Glyco_hydro_43
Motif
Other DBs
NCBI-ProteinID: BAH65040
Position
complement(4351438..4352880)
Genome map
AA seq 480 aa AA seqDB search
MKMMTYTISRAEQVLQTQRQALNLRWYPHYHLAARAGWINDPNGLVWFDGWYHAFYQHHP
YSTQWGPMHWGHARSKDLVHWEHLPVALAPEGPEDKDGCFSGSAVVDGDTLALIYTGHKF
HGDPGDEANLYQVQCLATSRDGIHFERQGMVVDTPPGMHHFRDPKVWREGDSWYMIVGAR
EGDTGQVRLYRSADLRQWQDAGVLDEAESTMGYMWECPDFFTLNGKRVLMFSPQGMQAAG
FSNRNLFQSGYLIGEWQPGQRFIRHGEFREMDNGHDFYAPQSFATPDGRRIVIGWLDMWE
SPLPEQQDGWAGMLSLPRELSLSADDRLQMRPAKEVESLRGAWFPWPVSTLNNQQTTMVD
NCEAMEVNLRWDCARSSAEQYGLRFGDGLRIYVDAQQQRLVLERHYPQYGLCGTRSVPLT
AGADLNLRIFFDSSSVEVFVNDGEACLSSRIYPQAPRRELALFAWSGSAALNEAGAWQLE
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
gtgaaaatgatgacttacacaatctcccgggctgaacaggtactccagacacaacgccag
gcgctgaatctgcgctggtatccgcactatcacctggcggcccgcgccgggtggatcaac
gacccaaacggtctggtgtggttcgacggctggtaccatgccttttatcaacatcacccg
tactccacccagtggggaccgatgcactgggggcacgcgcgcagtaaggatctggtgcac
tgggagcatttgccggtagccctggcgccggagggcccggaggataaagacggctgcttc
tccggctcggcggtggtcgatggcgataccctggcgctgatttacaccgggcataagttc
cacggcgatcctggcgacgaagccaatctgtatcaggtgcagtgtctggccaccagccgc
gacgggatccactttgagcgccagggaatggtggtcgacaccccgccgggtatgcaccac
ttccgtgacccgaaggtctggcgtgaaggagacagctggtacatgatcgtcggcgcgcgc
gaaggcgataccggccaggtgcggctgtaccgttcagccgatctgcgccagtggcaggac
gcgggggtgctggatgaagcggaaagcaccatgggctatatgtgggagtgcccggacttc
ttcaccctcaacggcaaacgcgttctgatgttttccccacaggggatgcaggccgcgggg
ttcagcaaccgcaatctgttccagagcggctatctgatcggcgagtggcagccaggccag
cgttttattcgccatggcgaattccgggagatggataacggccacgatttctatgccccg
caaagcttcgccacccccgatggccggcggatcgtgattggctggctggatatgtgggaa
tcgccgctgccggagcagcaggacggctgggcgggcatgctctccctgccgcgcgagctg
agcctgagtgcggatgaccgcctgcagatgcgcccggcgaaagaagtggagagcctgcgc
ggcgcctggttcccgtggccggtcagcaccctgaacaaccagcagacgacgatggtcgac
aactgcgaggcgatggaggtgaatctgcgctgggactgcgcccgcagcagcgccgagcag
tatggtctgcgctttggcgatggcctgcgcatctacgtggatgcccaacagcagcgtctg
gtgctggagcggcattatccgcagtatggcctgtgcgggacgcgcagcgtgccgttgacc
gccggagcggatctcaacctgcgaatatttttcgatagctcttcggtggaggtttttgtc
aatgacggcgaagcctgcctgagcagccgtatctatccgcaggctccccgccgtgaatta
gcgttatttgcctggagcggctcggcggcattaaacgaagccggcgcctggcagctcgaa
taa

DBGET integrated database retrieval system