KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_5106Help
Entry
KP1_5106          CDS       T00910                                 

Gene name
ompR
Definition
(GenBank) osmolarity response regulator
  KO
K07659  two-component system, OmpR family, phosphate regulon response regulator OmpR
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KP1_5106 (ompR)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02022 Two-component system [BR:kpu02022]
    KP1_5106 (ompR)
Two-component system [BR:kpu02022]
 OmpR family
  EnvZ-OmpR (osmotic stress response)
   KP1_5106 (ompR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg Trans_reg_C FleQ
Motif
Other DBs
NCBI-ProteinID: BAH65550
Position
complement(4837481..4838215)
Genome map
AA seq 244 aa AA seqDB search
MGVQTMQENYKILVVDDDMRLRALLERYLTEQGFQVRSVANAEQMDRLLTRESFHLMVLD
LMLPGEDGLSICRRLRSQSNPMPIIMVTAKGEEVDRIVGLEIGADDYIPKPFNPRELLAR
IRAVLRRQANELPGAPSQEEAVIAFGKFKLNLGTREMFREDEPMPLTSGEFAVLKALVSH
PREPLSRDKLMNLARGREYSAMERSIDVQISRLRRMVEEDPAHPRYIQTVWGLGYVFVPD
GSKA
NT seq 735 nt NT seq  +upstreamnt  +downstreamnt
ttgggagtacaaacaatgcaagagaattataagattctggttgtggatgacgacatgcgc
ctgcgtgcgctgctcgagcgttatctgaccgagcagggcttccaggttcgtagcgtggcg
aacgccgaacagatggatcgtctgttaacccgtgaatccttccacctgatggtgctggat
ctgatgctgccgggcgaagatggtctctctatctgccgtcgtctgcgcagccagagtaac
ccgatgccgatcattatggtgacggcgaaaggcgaagaggtcgatcggatcgtgggtctg
gagatcggggctgacgactatattccgaagccgtttaacccgcgcgaactgctggcccgc
atccgggcggtgctgcgccgccaggcgaacgagctgccgggcgcgccgtcgcaggaagag
gcggttatcgcctttggtaaattcaaactgaatttaggcacccgcgagatgttccgtgaa
gacgagccgatgccgttgaccagcggcgaattcgcggtcctgaaggcgctggtgagccat
ccccgtgagccgctgtcgcgcgataagctgatgaacctcgcccgcggccgcgaatactct
gcgatggagcgctccatcgacgtacagatctcccgcctgcgccgcatggtggaagaggac
ccggcgcatccgcgctacatccagaccgtctggggtctgggctacgtcttcgtcccggac
ggttctaaggcatga

DBGET integrated database retrieval system