KEGG   Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1): KP1_5290Help
Entry
KP1_5290          CDS       T00910                                 

Gene name
mtlD
Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
kpu  Klebsiella pneumoniae subsp. pneumoniae NTUH-K2044 (serotype K1)
Pathway
kpu00051  Fructose and mannose metabolism
kpu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KP1_5290 (mtlD)
Enzymes [BR:kpu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     KP1_5290 (mtlD)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: BAH65722
Position
5040290..5041453
Genome map
AA seq 387 aa AA seqDB search
MKVNTMKALHFGAGNIGRGFIGKLLADAGIELTFADVNQTVLDALNARHSYQVHVVGENE
QVDTVSGVNAVSSIGDEVVDLIAEVDLVTTAVGPVVLERIAPAIAKGLAQRKAQGTERPL
NIIACENMVRGTTQLKGHVFNALAEEDKAWVEAHIGFVDSAVDRIVPPSASATHDPLEVT
VETFSEWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTI
RDAILDEKIRAVVQGAMEESGAVLIKRYAFDPQKHAAYIQKILGRFENPYLKDDVERVGR
QPLRKLSAGDRLIKPLLGTLEYGLPHRNLVKGIAAAMHFRSEDDPQAQELAALIADKGPQ
AALAQISGLDAASDVVAEAVNDYNAEK
NT seq 1164 nt NT seq  +upstreamnt  +downstreamnt
ttgaaggttaatactatgaaagcattacattttggcgcaggtaatatcggacgtggcttt
atcggtaaattgctggccgacgcgggcatcgaactgacgtttgccgatgtcaatcagacc
gtacttgatgccctgaatgcccgtcatagctatcaggttcacgtcgtcggtgagaatgag
caggtggacaccgtctccggcgtcaatgccgtcagcagcatcggcgatgaggttgtggac
ctgatcgctgaggtggatctggtcaccaccgccgtcggtcccgtcgtgctcgagcgcatc
gcgccagcgatcgccaaagggctggcgcagcgcaaagcgcagggcaccgaacgcccgctg
aacatcatcgcctgcgaaaatatggtgcgcggcaccacgcagttaaaaggccacgtgttt
aacgcgctggcggaagaagataaagcgtgggtggaagcgcatatcggctttgtcgactct
gccgtagaccgtattgtgccgccatcggcttccgccactcatgacccgctggaagtcacc
gtggaaacctttagcgaatggattgtcgataagactcagttcaagggcgcgctgccgact
atcccgggaatggaattaactgataacctgatggcatttgtcgaacgcaagctcttcacc
ttgaacaccgggcatgctataaccgcctacctcggaaaactggcgggccatcagacgatt
cgcgacgcgatcctcgacgagaaaattcgtgccgtcgtgcagggcgcgatggaagagagc
ggcgcggtgctgatcaaacgttacgcctttgacccgcagaagcacgcggcttatatccag
aaaatacttggccgtttcgagaacccgtacctgaaagacgatgttgagcgcgttggccgt
cagccgctgcgcaaactgagcgctggcgaccgtttaattaagccgctgctgggtacactg
gaatacgggctgccgcaccgcaacctggtgaaagggattgcggcggcgatgcatttccgt
agcgaagacgatccgcaggcgcaggagctggcggcactgatcgccgacaaggggccgcag
gccgcgctggcgcagatttccggcctggatgccgcaagtgatgtcgtcgcggaggccgtt
aacgactacaacgcggaaaaatga

DBGET integrated database retrieval system