KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH29: KPNIH29_12485Help
Entry
KPNIH29_12485     CDS       T03465                                 

Definition
(GenBank) malate:quinone oxidoreductase
  KO
K00116  malate dehydrogenase (quinone) [EC:1.1.5.4]
Organism
kpv  Klebsiella pneumoniae subsp. pneumoniae KPNIH29
Pathway
kpv00020  Citrate cycle (TCA cycle)
kpv00620  Pyruvate metabolism
kpv01100  Metabolic pathways
kpv01110  Biosynthesis of secondary metabolites
kpv01120  Microbial metabolism in diverse environments
kpv01130  Biosynthesis of antibiotics
kpv01200  Carbon metabolism
Module
kpv_M00009  Citrate cycle (TCA cycle, Krebs cycle)
kpv_M00011  Citrate cycle, second carbon oxidation, 2-oxoglutarate => oxaloacetate
Brite
KEGG Orthology (KO) [BR:kpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00020 Citrate cycle (TCA cycle)
    KPNIH29_12485
   00620 Pyruvate metabolism
    KPNIH29_12485
Enzymes [BR:kpv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.5  With a quinone or similar compound as acceptor
    1.1.5.4  malate dehydrogenase (quinone)
     KPNIH29_12485
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mqo DAO K_oxygenase FAD_binding_3 Pyr_redox_2
Motif
Other DBs
NCBI-ProteinID: AIX69322
UniProt: A0A422Y486
Position
2526639..2528294
Genome map
AA seq 551 aa AA seqDB search
MPAMKKTIISLTALAMFVSAATHAEADTSKKTDFLLIGGGIMSASLGTWLQALQPDWDLT
MVEKLDGVALESSNGWNNAGTGHSANMELNYTPERADGSIDVSKALDINEQFMISRQFWS
AQVKRGILHDPHSFINSTPHMSFVWGDNVDYLQKRYNALQQTTLFQGMKFSTDHAQIKQW
APLVMEGRDPQQKVAATWTPVGTDVNYGEITRQLIGSLKKNNHFTLQTSSEVTDFKRNAD
NSWHVTIKNVQSGEAQTIDAKYVFIGAGGGALKLLQKTGIPEADNYAGFPVGGSFLMTEN
PAVTAQHLEKVYGQASVGAPPMSVPHLDARYLDGKRVVLFGPFATFSTKFLKNGSFFDLL
STTTTNNVLPMTHVGLDNFDLVKYLVSQVMLSDDDRFAALKEYYPDARKEDWKLIQAGQR
VQIIKKDAEKGGVLKLGTEVVVDQQKTISALLGASPGASTAAPITLNVLKQMFPQQFNSP
EWQSRIHAIVPSYGQKLNGNVALTQQVWDDTAATLQLTKPPVIQMPAAAPTATAKPAETP
REASPQHDMAL
NT seq 1656 nt NT seq  +upstreamnt  +downstreamnt
atgcctgcaatgaaaaaaacgattatttccttaaccgcattagcgatgttcgtcagcgcg
gcgacgcatgctgaagcggatacctcgaaaaaaaccgacttcctgctgattggcggcggg
atcatgagcgcctcgctcggcacctggctgcaggcgctgcagccggactgggatctgacc
atggtggagaaactggacggcgtggcgctggagtcttccaacggctggaataatgccggt
actggccactcggcgaatatggagctgaactatacgccggagcgggcggacgggtcgatt
gacgtcagcaaagcgctcgatattaacgagcaatttatgatttcccgtcagttctggtcg
gcacaggtgaaacgcggtattttgcacgatccgcactcgtttattaattccacgccgcat
atgagcttcgtctggggtgataatgtggattatctgcagaagcgttataacgcgctgcag
cagaccaccttattccaggggatgaaattctccaccgatcacgcgcaaattaaacagtgg
gcgccgctggtgatggaaggccgcgatccgcagcagaaagtggcagccacctggacgccg
gtgggtaccgatgtcaactacggcgaaatcactcgccagctgatcggcagcctgaagaaa
aataaccacttcaccctgcagacctcctctgaggtaacggatttcaaacgtaatgccgac
aactcctggcacgtaacgattaagaatgtgcagagcggggaagcgcagactattgacgcc
aaatacgtctttatcggcgccggcggcggcgcgttgaagctgctgcaaaaaaccggtatc
ccggaagcggacaactatgccggcttcccggtgggcggctcgttcctgatgaccgagaac
ccggcggtcaccgcgcagcacctggagaaagtgtatggccaggcttcagtcggcgcgccg
ccgatgtcggtgccgcaccttgatgcacgttacctcgacggtaagcgcgtggtgctgttc
gggccattcgccaccttctcgaccaagttcctgaaaaatggttcgttcttcgatctgctc
agcactaccaccaccaataacgtgctgccgatgacccacgtcggtctcgacaacttcgat
ctggtgaaatacctggttagccaggtgatgctcagcgatgatgaccgtttcgctgcgctg
aaagagtactacccggacgcgcgtaaagaagactggaaactgatccaggccggccagcgc
gtccagatcatcaagaaagacgcagagaagggcggcgtgctgaagctcggtaccgaagtg
gtggtcgatcagcagaaaaccatttccgcgctgctcggcgcttcgccgggggcttccacc
gccgcgccgatcaccctgaacgtgctcaagcagatgttcccgcagcagtttaactcgccg
gagtggcagagccgcattcacgctattgtgccgagctacggccagaagctgaacggtaac
gtggcgctgacccagcaggtttgggatgacaccgctgcgaccctgcagctgacgaaaccg
ccggtgatccagatgccagcggctgcgcctaccgcgaccgccaagccggcagagacgccg
cgcgaggcctcgccgcagcacgatatggcgctgtaa

DBGET integrated database retrieval system