KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH29: KPNIH29_15190Help
Entry
KPNIH29_15190     CDS       T03465                                 

Definition
(GenBank) acetyl-CoA acetyltransferase
  KO
K00626  acetyl-CoA C-acetyltransferase [EC:2.3.1.9]
Organism
kpv  Klebsiella pneumoniae subsp. pneumoniae KPNIH29
Pathway
kpv00071  Fatty acid degradation
kpv00072  Synthesis and degradation of ketone bodies
kpv00280  Valine, leucine and isoleucine degradation
kpv00310  Lysine degradation
kpv00362  Benzoate degradation
kpv00380  Tryptophan metabolism
kpv00620  Pyruvate metabolism
kpv00630  Glyoxylate and dicarboxylate metabolism
kpv00640  Propanoate metabolism
kpv00650  Butanoate metabolism
kpv00900  Terpenoid backbone biosynthesis
kpv01100  Metabolic pathways
kpv01110  Biosynthesis of secondary metabolites
kpv01120  Microbial metabolism in diverse environments
kpv01130  Biosynthesis of antibiotics
kpv01200  Carbon metabolism
kpv01212  Fatty acid metabolism
kpv02020  Two-component system
Brite
KEGG Orthology (KO) [BR:kpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPNIH29_15190
   00630 Glyoxylate and dicarboxylate metabolism
    KPNIH29_15190
   00640 Propanoate metabolism
    KPNIH29_15190
   00650 Butanoate metabolism
    KPNIH29_15190
  09103 Lipid metabolism
   00071 Fatty acid degradation
    KPNIH29_15190
   00072 Synthesis and degradation of ketone bodies
    KPNIH29_15190
  09105 Amino acid metabolism
   00280 Valine, leucine and isoleucine degradation
    KPNIH29_15190
   00310 Lysine degradation
    KPNIH29_15190
   00380 Tryptophan metabolism
    KPNIH29_15190
  09109 Metabolism of terpenoids and polyketides
   00900 Terpenoid backbone biosynthesis
    KPNIH29_15190
  09111 Xenobiotics biodegradation and metabolism
   00362 Benzoate degradation
    KPNIH29_15190
 09130 Environmental Information Processing
  09132 Signal transduction
   02020 Two-component system
    KPNIH29_15190
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:kpv04147]
    KPNIH29_15190
Enzymes [BR:kpv01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.9  acetyl-CoA C-acetyltransferase
     KPNIH29_15190
Exosome [BR:kpv04147]
 Exosomal proteins
  Exosomal proteins of other body fluids (saliva and urine)
   KPNIH29_15190
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Thiolase_N Thiolase_C ketoacyl-synt
Motif
Other DBs
NCBI-ProteinID: AIX69816
Position
3038442..3039623
Genome map
AA seq 393 aa AA seqDB search
MTDIAIVAAVRTPVGSFRGAFAPLSAVDLGAAVVRGLLERSQLPAAAVDELIFGQVLTAG
CGQNPARQTALRAGLPVDTPAVTVNLVCGSGLKAVQQAVQAIRCGDAGIVIAGGQESMSN
APYLMHGARDGLRFGHASLQDSMIQDGLWDAFNDYHMGITAENLADAFDISRERQDAFAA
SSQRKAAAAIAAGRFREEIVPVSVPQGKKPPRFVTDDEQPRPETSEQQLAQLRPAFRPAD
GSVTAGNASSLNDGAAAVLLMRVDKARELGLPVLARIVSSAVAGVDPSVMGIGPVSACRQ
ALHRAGWTLDEVDLIEANEAFAVQALAVGQLLEWDSEKVNVNGGAIALGHPIGASGCRIL
VSLVHEMQRRGASKGLATLCVGGGQGIAMTLQR
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atgaccgatattgccattgttgctgcagtacgcaccccggtaggcagctttcgcggcgcc
ttcgcccctctttccgccgtcgacctcggcgcggcggtggtgcgcggcctgcttgaacgc
tcccagctgcccgccgcagcggtcgacgaactaattttcggccaggtgctcaccgccggc
tgcgggcagaacccggcgcgccagaccgcgctgcgggccggcctgccggtcgacactccg
gcggtcaccgtcaatctggtctgcggctccgggctgaaagcggttcagcaggcggtgcag
gcgatccgctgcggcgacgccgggatcgttatcgccggcggccaggagagcatgagcaat
gctccctatctgatgcatggcgcccgcgacggcctgcgtttcggccacgccagcctgcag
gacagcatgattcaggacggcctgtgggacgcctttaacgactaccacatgggcattacc
gccgagaacctcgccgacgccttcgacatcagccgcgagcgccaggacgccttcgccgcc
agctcccagcgcaaagcggcggccgctatcgccgccgggcgctttcgtgaggagatcgtt
ccggtcagcgtcccgcagggcaaaaagccgccgcgattcgtgactgacgatgagcaaccc
cgcccggagaccagcgagcagcagttggcccagctgcgcccggcgtttcgcccggctgac
ggcagcgtcaccgccgggaatgcctcgtcgctgaacgacggcgccgcggcggtcctgctg
atgcgcgtcgataaagcgcgcgagcttgggctgccggtgctggcgcgcattgtcagctca
gcggtcgccggggtcgacccatcggtgatgggcatcggcccggtgagcgcctgccgccag
gcgctgcatcgcgccggctggacgctggacgaggtggaccttatcgaagccaacgaggct
tttgccgtccaggcgctggccgtcggtcagctgcttgagtgggatagcgagaaggtcaac
gtcaacggcggcgccatcgccctgggccatcccatcggcgcctccggctgccggatcctc
gtcagcctggtgcatgagatgcagcgccggggcgccagcaaagggctggcaaccctgtgc
gtcggcggcggccagggcatcgccatgacgctacaacgttaa

DBGET integrated database retrieval system