KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH29: KPNIH29_18740Help
Entry
KPNIH29_18740     CDS       T03465                                 

Definition
(GenBank) acetate kinase
  KO
K00925  acetate kinase [EC:2.7.2.1]
Organism
kpv  Klebsiella pneumoniae subsp. pneumoniae KPNIH29
Pathway
kpv00430  Taurine and hypotaurine metabolism
kpv00620  Pyruvate metabolism
kpv00640  Propanoate metabolism
kpv00680  Methane metabolism
kpv01100  Metabolic pathways
kpv01120  Microbial metabolism in diverse environments
kpv01200  Carbon metabolism
Module
kpv_M00579  Phosphate acetyltransferase-acetate kinase pathway, acetyl-CoA => acetate
Brite
KEGG Orthology (KO) [BR:kpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    KPNIH29_18740
   00640 Propanoate metabolism
    KPNIH29_18740
  09102 Energy metabolism
   00680 Methane metabolism
    KPNIH29_18740
  09106 Metabolism of other amino acids
   00430 Taurine and hypotaurine metabolism
    KPNIH29_18740
Enzymes [BR:kpv01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.2  Phosphotransferases with a carboxy group as acceptor
    2.7.2.1  acetate kinase
     KPNIH29_18740
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Acetate_kinase BcrAD_BadFG
Motif
Other DBs
NCBI-ProteinID: AIX70457
Position
3782704..3783906
Genome map
AA seq 400 aa AA seqDB search
MSSKLVLVLNCGSSSLKFAILDAVNGDEYLSGLAECFHLPEARIKWKMDGSKQEAELGAG
AAHSEALNFIVNTILAQKPELSAQLTAIGHRIVHGGEKYTSSVVIDESVIQGIKDAASFA
PLHNPAHLIGIAEALKSFPQLKDKNVAVFDTAFHQTMPEESYLYALPYSLYKEHGVRRYG
AHGTSHFYVTQEAAKILNKPVEELNIITCHLGNGGSVSAIRNGKCVDTSMGLTPLEGLVM
GTRSGDIDPAIIFHLHDTLGMSVDAINKMLTKESGLLGLTEVTSDCRYVEDNYQEKADAK
RAMDVYCHRLAKYIGSYTALMDGRLDAVIFTGGIGENAAMVRELSLGKLGVLGFEVDHER
NLAARFGKSGFINKEGTRPAVVIPTNEELVIAQDASRLTA
NT seq 1203 nt NT seq  +upstreamnt  +downstreamnt
atgtcgagtaagttagtactggttctgaactgcggtagctcctctctgaaatttgctatc
cttgacgccgtgaacggcgacgaatatctgtccggtttagcggaatgcttccacctgccg
gaagcccgtatcaaatggaaaatggacggcagcaaacaagaagccgagttaggcgcgggc
gccgcgcacagtgaagcgctgaactttatcgttaacactattctggcacaaaaaccagaa
ctgtctgctcagctgaccgcaatcggccaccgtatcgtacacggcggtgaaaaatacacc
agctccgtggtgatcgacgagtccgtaattcagggtattaaagacgccgcgtctttcgca
ccgctgcacaacccggcacacctgatcggcatcgctgaagcgctgaaatctttcccgcaa
ctgaaagacaaaaacgtggctgtattcgatacggcgttccatcagaccatgccggaagaa
tcctatctctacgccctgccgtacagcctgtacaaagagcacggcgttcgtcgttacggc
gcgcacggcaccagccacttctacgtgactcaggaagccgctaagatcctcaacaagccg
gtggaagagctgaacatcatcacctgccacctcggcaacggtggttctgtttccgctatc
cgtaacggtaaatgcgttgacacctccatgggtctgaccccgctggaaggcctggtgatg
ggtacccgctccggtgacatcgatccggccatcatcttccatctgcacgacaccctgggc
atgagcgttgacgcgatcaacaaaatgctgaccaaagagtccggcctgctgggtctgacc
gaagtcaccagcgactgccgctacgtggaagacaactatcaggaaaaagccgacgctaaa
cgcgcgatggacgtttactgccaccgcctggcgaaatacatcggttcctacaccgcgctg
atggacggccgtcttgacgccgttattttcaccggtggtatcggtgaaaacgccgcgatg
gtgcgtgagctgtcgctgggcaaactgggcgtactgggctttgaagttgaccatgagcgt
aaccttgctgcccgcttcggcaagtctggcttcatcaacaaagaaggcacccgtcctgcc
gtggttatcccgaccaacgaagagctggtcatcgcgcaagacgccagccgtctgaccgca
taa

DBGET integrated database retrieval system