KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH29: KPNIH29_25265Help
Entry
KPNIH29_25265     CDS       T03465                                 

Definition
(GenBank) mannitol-1-phosphate 5-dehydrogenase
  KO
K00009  mannitol-1-phosphate 5-dehydrogenase [EC:1.1.1.17]
Organism
kpv  Klebsiella pneumoniae subsp. pneumoniae KPNIH29
Pathway
kpv00051  Fructose and mannose metabolism
kpv01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:kpv00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00051 Fructose and mannose metabolism
    KPNIH29_25265
Enzymes [BR:kpv01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.17  mannitol-1-phosphate 5-dehydrogenase
     KPNIH29_25265
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Mannitol_dh_C Mannitol_dh 3HCDH_N ApbA Sacchrp_dh_NADP
Motif
Other DBs
NCBI-ProteinID: AIX71673
Position
5079303..5080451
Genome map
AA seq 382 aa AA seqDB search
MKALHFGAGNIGRGFIGKLLADAGIELTFADVNQTLLDALNARHSYQVHVVGENEQVDTV
SGVNAVSSIGDEVVDLIAEVDLVTTAVGPVVLERIAPAIAKGLAQRKAQGTERPLNIIAC
ENMVRGTTQLKGHVFNALAEEDKAWVEAHIGFVDSAVDRIVPPSASATHDPLEVTVETFS
EWIVDKTQFKGALPTIPGMELTDNLMAFVERKLFTLNTGHAITAYLGKLAGHQTIRDAIL
DEKIRAVVQGAMEESGAVLIKRYAFDPQKHAAYIQKILGRFENPYLKDDVERVGRQPLRK
LSAGDRLIKPLLGTLEYGLPHRNLVKGIAAAMHFRSEDDPQAQELAALIADKGPQAALAQ
ISGLDAASDVVAEAVNDYNAEK
NT seq 1149 nt NT seq  +upstreamnt  +downstreamnt
atgaaagcattacattttggcgcaggtaatatcggacgtggctttatcggtaaattgctg
gccgacgcgggcattgaactgacgttcgccgatgtcaatcagaccttacttgatgccctg
aatgcccgtcatagctatcaggttcacgtcgtcggtgagaatgagcaggtggacaccgtc
tccggcgtcaatgccgtcagcagcatcggcgatgaggttgtggacctgatcgctgaggtg
gatctggtcaccaccgccgtcggtcccgtcgtgctcgagcgcatcgcgccagcgatcgcc
aaagggctggcgcagcgcaaagcgcagggcaccgaacgcccgctgaacatcatcgcctgc
gaaaatatggtgcgcggcaccacgcagttaaaaggccacgtgtttaacgcgctggcggaa
gaagataaagcgtgggtggaagcgcatatcggctttgtcgactctgccgttgaccgtatt
gtgccgccatcggcttccgccactcatgacccgctggaagtcaccgtggaaacctttagc
gaatggattgtcgataagactcagttcaagggcgcgctgccgactatcccggggatggaa
ttaactgataacctgatggcatttgtcgaacgcaagctcttcaccttgaacaccgggcat
gctataaccgcctacctcggaaaactggcgggccatcagacgattcgcgacgcgatcctc
gacgagaaaattcgtgccgtcgtgcagggcgcgatggaagagagcggcgcggtgctgatc
aaacgttacgcctttgacccgcagaagcacgcggcttatatccagaaaatacttggccgt
ttcgagaacccgtacctgaaagacgatgttgagcgcgttggccgtcagccgctgcgcaaa
ctgagcgctggcgaccgtttaattaagccgctgctgggtacactggaatacgggctgccg
caccgcaacctggtaaaagggattgcggcggcgatgcatttccgtagcgaagacgatccg
caggcgcaggagctggcggcactgatcgccgacaaggggccgcaggccgcgctggcgcag
atttccggcctggatgccgcaagtgatgtcgtcgcggaggccgttaacgactacaacgcg
gaaaaatga

DBGET integrated database retrieval system