KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_00625Help
Entry
KPNIH30_00625     CDS       T03466                                 

Definition
(GenBank) acetolactate synthase catalytic subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw00650  Butanoate metabolism
kpw00660  C5-Branched dibasic acid metabolism
kpw00770  Pantothenate and CoA biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01210  2-Oxocarboxylic acid metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KPNIH30_00625
   00660 C5-Branched dibasic acid metabolism
    KPNIH30_00625
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_00625
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_00625
Enzymes [BR:kpw01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     KPNIH30_00625
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M POR_N XFP_N
Motif
Other DBs
NCBI-ProteinID: AIX76804
UniProt: A0A235WKV0
Position
129397..131043
Genome map
AA seq 548 aa AA seqDB search
MNGAQWVVHALRTQGVDTVFGYPGGAIMPVYDALYDGGVEHLLCRHEQGAAMAAIGYARA
TGKTGVCIATSGPGATNLITGLADALLDSIPIVAITGQVAAPFIGTDAFQEVDVLGLSLA
CTKHSFLVQSLDELPRVIAEAFQVANSGRPGPVLVDIPKDIQMAQGDLDPHFSTVADEMA
FPQAEVAQALQMLAQSQQPMLYVGGGVGMAQAVPALREFLAVTRMPATCTLKGLGVVDAD
YPYYLGMLGMHGTKAANLAVQECDLLIAVGARFDDRVTGKLNTFAPHAKVIHMDIDPAEL
NKLRQAHIGLTGDLNCLLPALQQPLAIDGWRERSAALRAEHAWRYDHPGEAIYAPLLLKQ
LSDRKPADSVVTTDVGQHQMWSAQHMTYTRPENFITSSGLGTMGFGLPAAVGAQVARPND
TVICISGDGSFMMNVQELGTVKRKQLPLKIVLLDNQRLGMVRQWQQLFFQERYSETTLTD
NPDFLTLASAFGIPGQHITRKDQVEAALDTMLSSQGPYLLHVSIDELENVWPLVPPGASN
SEMLEKLS
NT seq 1647 nt NT seq  +upstreamnt  +downstreamnt
atgaatggcgcgcagtgggtggtacatgctttgcggacacagggagtcgacacagttttt
ggctatccgggtggcgcaattatgccggtttacgatgcactgtatgacggcggcgtggag
cacctgctgtgccggcatgagcaaggggcagccatggcggccattggttatgcgcgagca
accggtaaaaccggggtgtgtatcgcgacgtccggcccgggcgcgaccaatctgatcacc
ggcctggcggacgccctgcttgactctattcccatcgtagctatcaccggccaggtggcc
gcacccttcatcggcacggatgcgttccaggaagtagatgttctcggtttgtcactggcc
tgtactaagcacagtttccttgtgcagtctctggacgaactgccgcgggttattgccgag
gctttccaggtggcaaactcaggccgtccaggtccggtgctggttgatatccctaaggat
attcagatggcgcagggcgacctcgatccccatttctctaccgtcgccgatgagatggca
tttccgcaggcggaagtggcgcaggctctgcagatgctggcccaatcgcagcaaccgatg
ctgtatgttggcggcggggtcggcatggcgcaggcggtaccggctttgcgcgaattcctg
gcggtgaccaggatgccggcaacctgcaccctgaaagggctgggcgtggtggatgctgat
tatccctattatctcggcatgctgggaatgcacggcactaaggcggccaacctggcggta
caggagtgcgatctgctgatcgccgtcggcgcgcgctttgacgatcgcgtaaccggtaag
ctcaataccttcgcaccgcatgccaaagtgatccacatggacatcgatccggcggagctg
aacaagctgcgtcaggcgcatatcggtctgacaggcgatctgaactgcctgctgccggcg
ctgcagcagccgttagctatcgatggctggcgcgagcggagtgccgcactgcgtgccgag
catgcctggcgttacgatcatcccggtgaggcaatctacgcgccgctgctgctgaagcag
ctttccgaccgcaagccggcggacagcgtggtgaccaccgacgttggccagcaccagatg
tggtcggctcagcatatgacctatacccgcccggaaaactttatcacctccagtggctta
ggcaccatgggctttggcctgccggccgccgttggcgcccaggtggcgcgccctaacgat
acggtgatctgtatctccggtgacggctccttcatgatgaatgtacaggagctgggcacc
gttaaacgcaagcagttaccgctgaagatcgtgttactcgacaaccagcggttagggatg
gttcgacaatggcagcagctgtttttccaggaacgttatagcgaaaccactctgactgat
aaccctgatttcctcacgctggccagcgccttcggtattcctggccaacacatcacccgt
aaagaccaggttgaagcggcactcgacaccatgctttcgagccaggggccatacctgctt
catgtctcaatcgacgaacttgagaatgtctggccgttggtgccgcccggcgccagtaac
tctgaaatgctggagaaattatcatga

KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_00630Help
Entry
KPNIH30_00630     CDS       T03466                                 

Gene name
ilvM
Definition
(GenBank) acetolactate synthase 2 regulatory subunit
  KO
K11258  acetolactate synthase II small subunit [EC:2.2.1.6]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw00650  Butanoate metabolism
kpw00660  C5-Branched dibasic acid metabolism
kpw00770  Pantothenate and CoA biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01210  2-Oxocarboxylic acid metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KPNIH30_00630 (ilvM)
   00660 C5-Branched dibasic acid metabolism
    KPNIH30_00630 (ilvM)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_00630 (ilvM)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_00630 (ilvM)
Enzymes [BR:kpw01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     KPNIH30_00630 (ilvM)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACT_5 ACT_4
Motif
Other DBs
NCBI-ProteinID: AIX76805
UniProt: A0A1Y0Q4I6
Position
131040..131297
Genome map
AA seq 85 aa AA seqDB search
MMQHQVALQARFNPETLERVLRVVRHRGFHICAMNMETAPDAQNINIELTVASPRPVELL
FSQLSKLVDVACVEIQQPTSQQIRA
NT seq 258 nt NT seq  +upstreamnt  +downstreamnt
atgatgcaacatcaggtcgctttacaggcacgtttcaacccggaaaccttagagcgcgtg
ctgcgcgttgtccgccaccggggtttccacatctgcgcaatgaacatggaaaccgcgccg
gacgcacagaacataaatatcgaattgaccgttgccagcccgcggcccgtcgaattactg
tttagtcaattaagcaaactggtcgacgttgcctgcgtcgagatccagcaacccacatca
caacaaatccgcgcctga

KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_04255Help
Entry
KPNIH30_04255     CDS       T03466                                 

Definition
(GenBank) acetolactate synthase 3 catalytic subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw00650  Butanoate metabolism
kpw00660  C5-Branched dibasic acid metabolism
kpw00770  Pantothenate and CoA biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01210  2-Oxocarboxylic acid metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KPNIH30_04255
   00660 C5-Branched dibasic acid metabolism
    KPNIH30_04255
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_04255
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_04255
Enzymes [BR:kpw01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     KPNIH30_04255
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M POR_N Kindlin_2_N ROQ_II XFP_N
Motif
Other DBs
NCBI-ProteinID: AIX77471
UniProt: A0A1Y0Q4V7
Position
849432..851156
Genome map
AA seq 574 aa AA seqDB search
MEMLSGAEMVVQSLVDQGVKQVFGYPGGAVLDIYDALHTLGGIDHVLVRHEQAAVHMADG
LARATGEVGVVLVTSGPGATNAITGIATAYMDSIPLVILSGQVATSLIGYDAFQECDMVG
ISRPVVKHSFLVKQTEDIPGVLKKAFWLAASGRPGPVVVDLPKDILNPAKKLPYVWPDAV
SMRSYNPTTSGHKGQIKRALQTLVAASKPVVYVGGGAINAHCEPQLRELVEKLKLPVASS
LMGLGAFPATHSQALGMLGMHGTYEANMTMHHSDVIFAVGVRFDDRTTNNLAKYCPNATV
LHIDIDPTSISKTVPADVPIVGDARLVLEQMLELLEQEEAQQPLDDIRDWWQQIEQWRAR
HCLRYDDQSDKIKPQAVIETIWRLTQGDAYVTSDVGQHQMFAALYYPFDKPRRWINSGGL
GTMGFGLPAALGVKMALPDEMVVCVTGDGSIQMNIQELSTALQYELPVLVLNLNNRYLGM
VKQWQDMLYSGRHSQSYMESLPDFVRLAEAYGHVGIRISEPQELETKLAEALEQVRQRRL
VFVDVTVDGSEHVYPMQIRGGGMDEMWLSKTERT
NT seq 1725 nt NT seq  +upstreamnt  +downstreamnt
atggagatgttgtcaggagccgagatggtcgtccaatcgcttgtcgatcagggcgtcaag
caagtattcggctatcccggaggcgcagtcctcgatatctatgatgcgttacataccctt
ggcggtatcgatcatgtgctggttcgtcacgagcaggcggcggtgcatatggcggatggc
ctggcgcgggcgaccggggaggtcggcgtggtgctggtgacctctgggcctggggcgacg
aacgccatcactggcattgcgacagcctatatggactctattccgttggtgatcctctcg
gggcaggtagccacctcgcttatcggctacgatgccttccaggagtgcgacatggtgggg
atttcccgtccggtggtgaagcacagtttcctggtgaagcagaccgaagatattcccggc
gtgctgaagaaagccttctggctggcggccagcggtcgccccggtccggtagtggtcgat
ctgccgaaggatattctcaatccggcgaagaagctgccttacgtctggccggacgcagtg
agcatgcgctcgtataacccaaccaccagtggccataaagggcagattaaacgcgccctg
cagaccctggtggccgcaagtaagccggtcgtctacgtcggcggcggggcgatcaatgcg
cattgcgaacctcagctgcgcgagctggtggaaaaactgaagctgccggtggcctcatcc
ttgatgggacttggcgctttcccggcgacacactcgcaggcgctggggatgctggggatg
cacggcacctatgaagccaacatgaccatgcaccactcggacgtgatttttgccgtcggc
gttcgctttgacgaccggaccaccaataacctggccaagtattgtccgaacgcgacggta
ctgcatattgatatcgatccgacttcaatctcgaaaaccgtgccggcagatgtgccgatc
gtcggcgatgcccggctggtgctggagcagatgctggagctgctggagcaggaggaagcg
cagcagccgctggacgacattcgcgactggtggcaacagatcgagcagtggcgtgcccgt
cattgtctgcgctacgacgaccagagcgataaaatcaaaccgcaggcggtaattgaaact
atctggcggctgacccagggcgatgcctacgtcacttccgatgtgggtcagcatcagatg
ttcgccgccctgtattaccccttcgataaaccgcggcgctggattaactccggtggtctc
ggcaccatgggctttggcctaccggctgcgctgggggtcaaaatggctctgccggacgaa
atggtggtctgcgtgaccggtgacggcagtatccagatgaacattcaggaactctccact
gcgctgcagtatgagctgccggtcctggtgcttaacctcaacaaccgctatctcgggatg
gtgaagcagtggcaggatatgctctattccgggcgtcactcgcagtcctatatggaatcg
ctaccggactttgtccgtctggcggaagcctatggccacgtcgggatccgcatcagcgag
ccgcaggagctggagacgaagcttgctgaagctctggagcaggtgcgccagcgtcggctg
gtgtttgtcgatgtgaccgtcgacggcagtgagcatgtgtaccccatgcagatccgcggc
ggcggcatggatgaaatgtggttgagcaaaacggagaggacctga

KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_04260Help
Entry
KPNIH30_04260     CDS       T03466                                 

Gene name
ilvH
Definition
(GenBank) acetolactate synthase 3 regulatory subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw00650  Butanoate metabolism
kpw00660  C5-Branched dibasic acid metabolism
kpw00770  Pantothenate and CoA biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01210  2-Oxocarboxylic acid metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KPNIH30_04260 (ilvH)
   00660 C5-Branched dibasic acid metabolism
    KPNIH30_04260 (ilvH)
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_04260 (ilvH)
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_04260 (ilvH)
Enzymes [BR:kpw01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     KPNIH30_04260 (ilvH)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ALS_ss_C ACT_5 ACT ACT_4 UvrB_inter
Motif
Other DBs
NCBI-ProteinID: AIX77472
UniProt: A0A2X3G7U5
Position
851159..851650
Genome map
AA seq 163 aa AA seqDB search
MRRILSVLLENESGALSRVIGLFSQRGYNIESLTVAPTDDPTLSRMTIQTVGDEKAIEQI
EKQLHKLVDVLRVSELGQGAHVEREIMLVKVQASGYGREEVKRNTEIFRGQIIDVTPSIY
TVQLAGTSDKLDAFLASLRDVARIVEVARSGVVGLSRGDKIMR
NT seq 492 nt NT seq  +upstreamnt  +downstreamnt
atgcgccggatattatcggtattactggaaaacgaatcgggtgcattgtcccgcgttatc
ggcctcttttcccagcgtggctataatatagaaagcctgactgtcgcgccgacggacgat
cccactctctccagaatgaccattcagaccgtgggcgatgaaaaagcgattgagcagatt
gaaaagcaactgcacaagctggtggatgtcctgcgggtcagcgagctggggcagggggct
catgttgaacgcgaaattatgctggtgaaggttcaggccagcggctatggccgtgaagaa
gtgaagcgcaacaccgaaatcttccgcggacagattatcgacgtgacgccttctatctat
accgtccagctcgccggcaccagcgataagctggatgcatttctggcctcgctgcgcgat
gtcgctcggattgtggaagtggctcgctccggcgtggtcggcctgtctcgcggtgataaa
atcatgcgctaa

KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_15480Help
Entry
KPNIH30_15480     CDS       T03466                                 

Definition
(GenBank) acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw00650  Butanoate metabolism
kpw00660  C5-Branched dibasic acid metabolism
kpw00770  Pantothenate and CoA biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01210  2-Oxocarboxylic acid metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KPNIH30_15480
   00660 C5-Branched dibasic acid metabolism
    KPNIH30_15480
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_15480
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_15480
Enzymes [BR:kpw01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     KPNIH30_15480
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M CO_dh HTH_18
Motif
Other DBs
NCBI-ProteinID: AIX79582
UniProt: A0A422VWN9
Structure
PDB: 

Position
3038894..3040573
Genome map
AA seq 559 aa AA seqDB search
MDKQYPVRQWAHGADLVVSQLEAQGVRQVFGIPGAKIDKVFDSLLDSSIRIIPVRHEANA
AFMAAAVGRITGKAGVALVTSGPGCSNLITGMATANSEGDPVVALGGAVKRADKAKQVHQ
SMDTVAMFSPVTKYAVEVTAPDALAEVVSNAFRAAEQGRPGSAFVSLPQDVVDGPVSGKV
LPASGAPQMGAAPDDAIDQVAKLIAQAKNPIFLLGLMASQPENSAALRRLLETSHIPVTS
TYQAAGAVNQDNFSRFAGRVGLFNNQAGDRLLQLADLVICIGYSPVEYEPAMWNSGNATL
VHIDVLPAYEERNYTPDVELVGDIAGTLNKLAQNIDHRLVLSPQAAEILRDRQHQRELLD
RRGAQLNQFALHPLRIVRAMQDIVNSDVTLTVDMGSFHIWIARYLYSFRARQVMISNGQQ
TMGVALPWAIGAWLVNPERKVVSVSGDGGFLQSSMELETAVRLKANVLHLIWVDNGYNMV
AIQEEKKYQRLSGVEFGPMDFKAYAESFGAKGFAVESAEALEPTLRAAMDVDGPAVVAIP
VDYRDNPLLMGQLHLSQIL
NT seq 1680 nt NT seq  +upstreamnt  +downstreamnt
atggacaaacagtatccggtacgccagtgggcgcacggcgccgatctcgtcgtcagtcag
ctggaagctcagggggtacgccaggtgttcggcatccccggcgccaaaatcgacaaggtc
ttcgattcactgctggattcctcgattcgcattattccggtacgccacgaagccaacgcc
gcatttatggccgccgccgtcggacgtattaccggcaaagcgggcgtggcgctggtcacc
tccggtccgggttgttctaacctgatcaccggcatggccaccgcgaacagcgaaggcgac
ccggtggtggccctgggcggcgcggtaaaacgcgccgataaagccaaacaggtccatcag
agtatggatacggtggcgatgttcagcccggtaaccaaatacgccgtcgaggtgacggcg
ccggatgcgctggcggaagtggtctccaacgccttccgcgccgccgagcagggccggccg
ggcagcgcgttcgttagcctgccgcaggatgtggtcgatggcccggtcagcggcaaagtg
ctgccggccagcggggccccgcagatgggcgccgcgccggatgatgccatcgaccaggtg
gcgaaacttatcgcccaggcgaagaacccgatcttcctgctcggcctgatggccagccag
ccggaaaacagcgccgcgctgcgccgtttgctggagaccagccatattccagtcaccagc
acctatcaggccgccggagcggtgaatcaggataacttctctcgcttcgccggccgggtt
gggctgtttaataaccaggccggggaccgtctgctgcagctcgccgacctggtgatctgc
atcggctacagcccggtggaatacgaaccggcgatgtggaacagcggcaacgcgacgctg
gtgcacatcgacgtgctgcccgcctatgaagagcgcaactacaccccggatgtcgagctg
gtgggcgatatcgccggcactctcaacaagctggcgcaaaatatcgatcatcggctggtg
ctctccccgcaggcggcggagatcctccgcgaccgccagcaccagcgcgagctgctggac
cgccgcggcgcgcagctcaaccagtttgccctgcatcccctgcgtatcgttcgcgccatg
caggacatcgtcaacagcgacgtcacgttgaccgtggacatgggcagcttccatatctgg
attgcccgctacctgtacagcttccgcgcccgccaggtgatgatctccaacggccagcag
accatgggcgtcgccctgccctgggccatcggcgcctggctggtcaatcctgagcgcaaa
gtggtctccgtctctggcgacggcggcttcctgcagtcgagcatggagctggagaccgcc
gtccgcctgaaagccaacgtgctgcatcttatctgggtcgataacggctacaacatggtc
gctatccaggaagagaaaaaatatcagcgcctgtccggcgtcgagttcgggccgatggat
tttaaagcctatgccgaatccttcggcgcgaaagggtttgccgtggaaagcgccgaggcg
ctggagccgaccctgcgcgcggcgatggacgtcgacggcccggcggtagtggccatcccg
gtagattatcgcgataacccgctgctgatgggccagctgcatctgagtcagattctgtaa

KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_20910Help
Entry
KPNIH30_20910     CDS       T03466                                 

Definition
(GenBank) acetolactate synthase
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw00650  Butanoate metabolism
kpw00660  C5-Branched dibasic acid metabolism
kpw00770  Pantothenate and CoA biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01210  2-Oxocarboxylic acid metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KPNIH30_20910
   00660 C5-Branched dibasic acid metabolism
    KPNIH30_20910
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_20910
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_20910
Enzymes [BR:kpw01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     KPNIH30_20910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M E1_dh
Motif
Other DBs
NCBI-ProteinID: AIX80591
UniProt: A0A3N0P1R7
Position
4157443..4159152
Genome map
AA seq 569 aa AA seqDB search
MASITLSAAELLLHRLQALDVAYIFINSGTDYPPVIEAWAKARATGQKVPELVICPHENA
AIGMAHGYYLGTGKVQAVMVHTNVGLANAACGVINLANSNIPVLIFGGRTPISEHSHFGC
RNTPIGYGQEMRDQAALIRESVKWDFELRLADQIGEHVDRAWAIASSLPKGPVYLSLPRE
PLCETFAVDEAALQAGPSQQPVRYAPVREDIARAAEAIACARHPVIFAQRGARTAEGFAR
LDSLVREWAIPLVEYWGTEVTLSADNPLLAGADPSVWLADADVILVVDSQAPWMIAEGDC
RQDCTVIQMGPDPLFSRYPVRGYRADINLAGETDEVFSLLEEALRPLQAARQQHVAERAA
YTQSRIQQQKNQRDALLHASQTGAITKPWLSYCLGHLANQHRGRIVSELTTLPQFAGLTQ
AESYYQEALAGGLGEALPIALGLQLARREELIIAAVGDGSYLFANPAVCHHIAEVMKLPV
LVVVGNNGGWGAVAGGTKALYPDGYAARAETIPATAFTTSPDFAAIAASSRAAALSVSRA
EDLPGVLEEAVSLIRTRRQSVLVDVQLAR
NT seq 1710 nt NT seq  +upstreamnt  +downstreamnt
atggcctctatcacattatcggctgctgaattgttactgcatcggctgcaggcgctggac
gtggcgtatatttttatcaactcgggcaccgattatcctccagtcattgaagcctgggca
aaggcccgggcgaccgggcaaaaggtaccggagttagtgatctgcccgcatgaaaacgcc
gccatcggcatggcccatggctattacctcggcaccggcaaggtgcaggcggtgatggtt
cacaccaacgtcgggctagccaacgccgcctgcggcgtcatcaatctggcgaacagcaat
atcccggtgctgatttttggcggccgcacgccgataagcgaacattcccacttcggctgc
cgcaatacgccgattggctacggccaggagatgcgcgaccaggcggcgctgatccgtgaa
tccgtgaagtgggattttgaactgcggctggccgatcagatcggcgagcatgttgaccgg
gcctgggcgattgccagctccctgccgaaagggccggtctacctgagcttaccgcgtgag
ccactgtgcgaaacctttgccgtcgatgaggccgcgctgcaggctggcccttcgcagcag
ccggtccgctatgcgccagtccgggaagatatcgcccgcgcagccgaggcaatcgcctgc
gccagacacccggtcatcttcgcccagcgcggcgcccgaacggcggaaggctttgcgcgc
ctcgatagtctggtgcgcgaatgggcgatccctctggtggaatactggggcaccgaggtt
accctgagcgccgataatcccctgctcgccggggctgatcccagcgtctggctcgctgac
gccgatgtgattctggtggtcgactcgcaggcaccatggatgatcgccgagggcgactgt
cgccaggactgcaccgtgatccagatggggcccgatccgctcttctcccgctacccggtg
cgcggctatcgcgcggacatcaacctggcgggcgagaccgatgaagtcttcagcctgctg
gaagaggcgctgcgcccgctgcaggccgcccgccagcagcatgtggcggagcgggcggca
tatacgcagagccgcatccagcaacagaaaaaccagcgcgacgcgcttctccatgccagc
cagaccggggccattaccaaaccctggctcagctactgcctcggccatctggctaatcaa
caccgcggccggatcgtttctgaactgaccacgctgccgcagtttgccggactgacccaa
gccgagagctattaccaggaagcgctggccggcggcctgggcgaagccctgcccatcgcg
ctggggctgcagcttgcgcgccgggaagaactgattattgccgccgtcggcgacgggtcg
tacctgttcgccaaccctgcggtctgccaccatattgcggaggtaatgaagctccctgtc
ctcgtcgtggtcggaaataacggcgggtggggcgccgtcgcgggcggcaccaaagcgctc
tacccggatggctacgcggcccgcgcggaaaccattccagccaccgcctttaccacctcg
ccggatttcgccgcgatcgccgcctccagccgcgcggcggccctgtcggtttcccgggcc
gaagatctccccggcgtgctggaagaagcggtatccctcatacgcacccgccgacaaagc
gtgctggttgacgtgcagttagcccgctaa

KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_22290Help
Entry
KPNIH30_22290     CDS       T03466                                 

Definition
(GenBank) hypothetical protein
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw00650  Butanoate metabolism
kpw00660  C5-Branched dibasic acid metabolism
kpw00770  Pantothenate and CoA biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01210  2-Oxocarboxylic acid metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KPNIH30_22290
   00660 C5-Branched dibasic acid metabolism
    KPNIH30_22290
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_22290
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_22290
Enzymes [BR:kpw01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     KPNIH30_22290
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_C TPP_enzyme_M DXP_synthase_N
Motif
Other DBs
NCBI-ProteinID: AIX80854
UniProt: A0A422VMR8
Position
complement(4435095..4436735)
Genome map
AA seq 546 aa AA seqDB search
MSEMITVGDAIARTLEQYHVEAIYGVISIHNLPIADAVGQREKIRFVPARGEAGSVTMAD
AHGRFSGLGVALTSTGAGAGNAVGALVEAMNAGTPLLHLTGQVEKAWLDADTGFIHETRD
QLTFLKASSKRAYRISNANQAVAILHKAIQEAQTPPCGPVSVEIPIDIQSAKIPLSLLTA
PLKRAPAVEPEASLVDALWAQLKQAKQPLLWLGGGALESGEAVKTLADAGVTVISSTHGR
GILADSHRASLRAFHNSPSVEALISQCDFTLVAGSRLRSNETRSWTLELPTPRVQIDIDP
AAASRNYLMDNTLVADCRALLAALAERVQGRIWGDARWDSQLKEAVEAAEQGLRDQCGDY
AKLNDAIAQALPDDGILVRDITVSGSLWGSRLFRAHGPLMNIHSLAGAIGMGLPMAVGTA
IANPQRKVVGLVGDGGLSLNLGELATLAQEKANVTLLIMNDGGYGVMRGIQDKYFGGRQY
YNELHTPDFSLLAQAMGLQAWSVDRAEDFQAVMTEALAMPGPSVVEVKMGQIGALRFAGP
PQKTLY
NT seq 1641 nt NT seq  +upstreamnt  +downstreamnt
atgagcgaaatgataaccgtcggcgatgccatcgccagaacgctggagcagtatcacgtt
gaagccatttatggcgtcatttctatccataacctgccgatcgccgatgccgtcggccag
cgggaaaaaatccgctttgttccggcgcgcggtgaagcgggctcggtgaccatggctgac
gcccacggccgtttttcagggctcggcgtggcgctgaccagtaccggcgcgggtgcgggt
aatgcggtcggcgcgctggttgaggcgatgaacgccggtacgccgctgctgcacctgacc
ggacaggtcgaaaaagcctggctggacgccgacaccggtttcattcatgaaacccgcgat
cagttgaccttcctgaaagccagttcgaagcgcgcttaccgcattagcaacgccaaccag
gcggtggctatcctgcataaggcgattcaggaggcgcagacgccgccgtgcggcccggtc
tcggtggagatcccaatcgacattcagagcgccaaaattccgctttcactgctgaccgcg
ccgctgaaacgcgctccggcggttgagccggaagcgtcgctggtcgatgcgctgtgggcg
cagcttaagcaggcgaagcagccgctgctgtggcttggcggcggcgcgttagagagcggc
gaggcggtgaagacgctggcggatgccggggtgacggtgatttccagtacccacggccgc
ggcattctggcggacagccatcgcgccagcctgcgcgcgtttcataattctccctcggtt
gaagcgctgatttcacaatgtgatttcacacttgttgccggttcccggctgcgcagcaac
gaaacgcgctcgtggacgctggaactgcccacgccgcgggtgcagattgatattgacccg
gcggcggccagccgtaactacttgatggacaataccctggtggcggattgccgggcgcta
ttagcggcgctggcagagcgggtgcagggccggatatggggcgatgcgcgttgggatagc
caacttaaagaggcggtagaggcggcggagcaggggctgcgcgaccagtgcggcgattac
gctaaattgaatgacgcgattgcgcaggcgctgcccgatgacggcatcctggtgcgcgat
attaccgtttctggcagcctgtggggcagccgtctgttccgcgctcacggcccgctgatg
aatatccattctctggccggagccatcggtatggggctaccgatggcggtgggtaccgcg
attgccaatccgcaacgtaaagtggtcggcctggtcggcgacggcggcctgagcctcaac
cttggcgaactggcgaccctggcgcaggagaaggccaatgtgacgctgttgattatgaat
gacggcggctacggcgtaatgcgtggtattcaggataagtattttggcggccgccagtat
tacaacgagctgcacacgccagacttttccctgctggcgcaggcgatgggtctgcaggcg
tggagcgtggatcgggctgaggatttccaggcggtgatgaccgaagcgctggcgatgccg
gggccatcggtggtggaagtgaagatgggccagattggcgcgctgcgctttgccggcccg
ccgcagaagacgctgtattaa

KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_26425Help
Entry
KPNIH30_26425     CDS       T03466                                 

Definition
(GenBank) acetolactate synthase 1 regulatory subunit
  KO
K01653  acetolactate synthase I/III small subunit [EC:2.2.1.6]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw00650  Butanoate metabolism
kpw00660  C5-Branched dibasic acid metabolism
kpw00770  Pantothenate and CoA biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01210  2-Oxocarboxylic acid metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KPNIH30_26425
   00660 C5-Branched dibasic acid metabolism
    KPNIH30_26425
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_26425
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_26425
Enzymes [BR:kpw01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     KPNIH30_26425
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ACT ACT_5 ACT_4
Motif
Other DBs
NCBI-ProteinID: AIX81644
UniProt: A0A1Y0PTQ0
Position
complement(5236992..5237279)
Genome map
AA seq 95 aa AA seqDB search
MQKQCDNVILELTVRNHPGVMTHVCGLFARRAFNVEGILCLPIQGSEHSRIWLLVNDDQR
LGQMISQIEKLEDVTKVARNQSDPTMFNKIAVFFE
NT seq 288 nt NT seq  +upstreamnt  +downstreamnt
atgcaaaaacaatgtgataacgtcattctggaactcaccgtccgcaaccatcccggcgtc
atgacccacgtgtgcgggctttttgcccgtcgcgcgtttaacgtcgaaggcattctctgt
ctgccaattcagggcagcgaacacagccgcatctggctgctggtaaatgatgaccagcga
ctggggcagatgattagccagattgaaaagctggaagatgtcaccaaagtggcgcgtaac
cagtccgatcccaccatgtttaacaaaattgcggtgttcttcgaatag

KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_26430Help
Entry
KPNIH30_26430     CDS       T03466                                 

Definition
(GenBank) acetolactate synthase catalytic subunit
  KO
K01652  acetolactate synthase I/II/III large subunit [EC:2.2.1.6]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw00650  Butanoate metabolism
kpw00660  C5-Branched dibasic acid metabolism
kpw00770  Pantothenate and CoA biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01210  2-Oxocarboxylic acid metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00650 Butanoate metabolism
    KPNIH30_26430
   00660 C5-Branched dibasic acid metabolism
    KPNIH30_26430
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_26430
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_26430
Enzymes [BR:kpw01000]
 2. Transferases
  2.2  Transferring aldehyde or ketonic groups
   2.2.1  Transketolases and transaldolases
    2.2.1.6  acetolactate synthase
     KPNIH30_26430
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TPP_enzyme_N TPP_enzyme_M TPP_enzyme_C CO_dh
Motif
Other DBs
NCBI-ProteinID: AIX81645
UniProt: A0A3N0L5T3
Position
complement(5237283..5238971)
Genome map
AA seq 562 aa AA seqDB search
MASSGTTSNTMRFTGAQLVVHLLERQGITMVSGIPGGSILPIYDALSQSTQIRHILARHE
QGAGFIAQGMARTEGKPAVCMACSGPGATNLVTAIADARLDSIPLVCITGQVPASMIGTD
AFQEVDTYGISIPITKHNYLVRDIAELPQVISDAFRIAQSGRPGPVWIDIPKDVQSATIE
LEALPEPGERAPAPAFAPESVREAAAMINAAKRPVLYLGGGVINAPQAIRELAEKANLPT
TMTLMALGMLPKAHPLSLGMLGMHGARSTNFILQEADLLIVLGARFDDRAIGKTEQFCPN
AKIIHVDIDRAELGKIKQPHVAIQGDVAEVLAQLNPHIEAQPREEWRQLVADLQREFPCA
IPQESDPLSHYGLINAVAACVDDEAIITTDVGQHQMWTAQAYPLNRPRQWLTSGGLGTMG
FGLPAAIGAALANPQRKVICFSGDGSLMMNIQEMATAAENQLDVKIILLNNEALGLVHQQ
QSLFYQQGVFAATYPGMINFMQIAAGFGLQTCDLNNEVDPQAALQAIIDRPGPALIHVRI
DAQQKVYPMVPPGAANTEMVGE
NT seq 1689 nt NT seq  +upstreamnt  +downstreamnt
atggcaagttcgggcaccacatcaaacacaatgcgctttaccggcgcgcagctggttgtt
catttactggagcgccagggtatcactatggtcagcggcattccgggcggctccatcctg
cctatctacgatgccttaagccagagcacgcagatccgccacatcctggcgcgccatgag
cagggcgcgggctttatcgcccaggggatggcgcgtaccgaaggcaagccggcggtctgt
atggcctgcagcggcccgggggcgacgaacctggtgacggcgatcgccgatgcccgcctg
gattcgattccgctggtctgcatcaccggccaggtaccggcctcgatgatcggtaccgac
gccttccaggaagtggacacctacggcatctctatccccatcaccaaacataactatctg
gtgcgcgacattgccgagctgccgcaggtgatcagcgacgccttccgtattgcccagtcc
gggcgtcccgggccggtgtggatagacattcctaaagacgtacagtcggcgaccattgag
ctggaagcgctgcctgagcctggcgagcgcgccccggcaccggcattcgcgcctgaaagc
gtgcgtgaagcggcggcaatgatcaacgcggcgaaacgcccggtactgtatctgggcggc
ggggtgattaacgcgccgcaggcgatccgtgagctggcggaaaaagccaacctgccgacc
accatgaccttaatggcgctgggcatgctgccgaaggcgcacccgctgtcgctggggatg
ctggggatgcacggcgcgcgcagcaccaactttattctgcaggaggcggatttactgatt
gttttaggcgcccgttttgatgaccgggcgattggcaagaccgagcagttctgcccgaac
gcgaagattatccacgtcgatatcgaccgcgccgaactgggcaaaatcaagcaaccgcac
gtggcgattcagggcgatgtggcggaagtcttagcccagctgaacccgcatattgaggcg
cagccgcgcgaggaatggcgccagctggtggccgacttgcagcgcgaattcccctgcgcc
atcccgcaggaaagcgacccgctctcccattacggcctgattaacgccgtggccgcctgc
gtggatgatgaagcgatcatcactaccgacgttggccagcaccagatgtggacggcgcag
gcctacccgctcaatcgtccgcgccagtggctgacctccggcggcctcggcaccatgggc
ttcggcctgccggcagccatcggcgcggcgctggcgaatccgcagcgcaaggttatctgc
ttctccggcgacggcagcctgatgatgaatattcaggagatggccaccgccgccgaaaat
cagctggatgtaaaaattatcctgctgaacaacgaagcgctggggctggtgcatcagcag
cagagcctgttctatcagcagggcgtttttgccgccacctatccggggatgattaacttt
atgcagattgccgccggttttggcctgcaaacctgtgatttaaataatgaagtcgatccg
caggcggcgctgcaggcgatcatcgaccgtccggggccggcgctgatccacgtgcgcatc
gacgcacagcagaaagtgtatccgatggtaccgccgggtgcggccaatactgaaatggtg
ggggaataa

DBGET integrated database retrieval system