KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_00635Help
Entry
KPNIH30_00635     CDS       T03466                                 

Definition
(GenBank) branched-chain amino acid aminotransferase
  KO
K00826  branched-chain amino acid aminotransferase [EC:2.6.1.42]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00270  Cysteine and methionine metabolism
kpw00280  Valine, leucine and isoleucine degradation
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw00770  Pantothenate and CoA biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01210  2-Oxocarboxylic acid metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kpw_M00119  Pantothenate biosynthesis, valine/L-aspartate => pantothenate
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00270 Cysteine and methionine metabolism
    KPNIH30_00635
   00280 Valine, leucine and isoleucine degradation
    KPNIH30_00635
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_00635
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_00635
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01007 Amino acid related enzymes [BR:kpw01007]
    KPNIH30_00635
Enzymes [BR:kpw01000]
 2. Transferases
  2.6  Transferring nitrogenous groups
   2.6.1  Transaminases
    2.6.1.42  branched-chain-amino-acid transaminase
     KPNIH30_00635
Amino acid related enzymes [BR:kpw01007]
 Aminotransferase (transaminase)
  Class IV
   KPNIH30_00635
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Aminotran_4
Motif
Other DBs
NCBI-ProteinID: AIX76806
UniProt: A0A2X3GLB4
Position
131314..132243
Genome map
AA seq 309 aa AA seqDB search
MTTKKADYIWFNGEMVPWGEAKVHVMSHALHYGTSVFEGIRCYDSHKGPVVFRHREHMQR
LHDSAKIYRFPVSQSVDELMEACREVIRTNNLTSAYIRPLVFVGDVGMGVNPPPGYNTDV
IIAAFPWGAYLGAEALEQGIDAMVSSWNRAAPNTIPTAAKAGGNYLSSLLVGSEARRHGY
QEGIALDVNGYISEGAGENLFEVKDGVLFTPPFTSSALPGITRDAIIKLAKDLGIEVREQ
VLSRESLYLADEVFMSGTAAEITPVRSVDGIQVGAGRRGPVTKRIQEAFFGLFTGETEDK
WGWLDPVSK
NT seq 930 nt NT seq  +upstreamnt  +downstreamnt
atgacgacgaaaaaagctgattacatttggttcaatggcgagatggttccgtggggcgaa
gcgaaagttcatgtgatgtcccatgcgctgcactacggtacctcggtattcgaggggatc
cgttgctacgactcgcacaaaggcccggtggtgttccgtcatcgcgaacatatgcagcgt
ctgcatgattcagccaaaatttatcgtttcccggtctcccagagcgtcgacgaactgatg
gaagcctgccgcgaagtcattcgaaccaataatctgaccagcgcttatatccgtccgctg
gtgtttgttggcgatgtcggcatgggggtaaacccgcctccgggttacaacactgacgtg
atcatcgcggcgttcccatggggagcctacctcggcgcagaagcgcttgagcaggggatc
gatgcaatggtctcttcctggaaccgcgcggcgccgaacactatcccgacggcagcgaaa
gccggtggtaattatctttcctcgctgctggttggcagtgaagcgcgtcgccatggctat
caggaaggtatcgccctcgatgttaacggctatatctccgaaggcgcaggggaaaacctg
tttgaagtgaaggacggtgtactgttcaccccgccgtttacctcttccgcgctgccgggc
attacccgcgacgccattatcaagctggcgaaagatcttggtatcgaagtccgcgagcag
gtgttgtcccgtgaatccctgtatctggcggatgaagtcttcatgtccggcactgcggcg
gaaatcaccccggtacgcagcgtggacggcatccaggtcggcgcaggccgtcgcggtccg
gtaaccaaacgcattcaggaagccttctttggcctcttcaccggtgaaacagaagataaa
tggggctggttggatccggtaagtaagtaa

DBGET integrated database retrieval system