KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_00640Help
Entry
KPNIH30_00640     CDS       T03466                                 

Definition
(GenBank) dihydroxy-acid dehydratase
  KO
K01687  dihydroxy-acid dehydratase [EC:4.2.1.9]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw00770  Pantothenate and CoA biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01210  2-Oxocarboxylic acid metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00019  Valine/isoleucine biosynthesis, pyruvate => valine / 2-oxobutanoate => isoleucine
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_00640
  09108 Metabolism of cofactors and vitamins
   00770 Pantothenate and CoA biosynthesis
    KPNIH30_00640
Enzymes [BR:kpw01000]
 4. Lyases
  4.2  Carbon-oxygen lyases
   4.2.1  Hydro-lyases
    4.2.1.9  dihydroxy-acid dehydratase
     KPNIH30_00640
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ILVD_EDD
Motif
Other DBs
NCBI-ProteinID: AIX76807
UniProt: A0A235U1A4
Position
132304..134154
Genome map
AA seq 616 aa AA seqDB search
MPKYRSATTTHGRNMAGARALWRATGMTDADFGKPIIAVVNSFTQFVPGHVHLRDLGKLV
AEQIEAAGGVAKEFNTIAVDDGIAMGHGGMLYSLPSRELIADSVEYMVNAHCADAMVCIS
NCDKITPGMLMASLRLNIPVIFVSGGPMEAGKTKLSDKIIKLDLVDAMIQGADPKVSDEQ
SNQVERSACPTCGSCSGMFTANSMNCLTEALGLSQPGNGSLLATHADRKELFLNAGKRIV
ELTKRYYEQDDASALPRNIASKAAFENAMTLDIAMGGSTNTVLHLLAAAQEAEIDFTMSD
IDKLSRKVPQLCKVAPSTQKYHMEDVHRAGGVLGILGELDRAGLLNREVKNVLGLTLPQT
LEQYDVMVTQDDAVKKMFRAGPAGIRTTQAFSQDCRWDTLDDDRAEGCIRSLEHAYSKDG
GLAVLYGNFAENGCIVKTAGVDDSILKFTGPAKVYESQDDAVEAILGGKVVEGDVVVIRY
EGPKGGPGMQEMLYPTSFLKSMGLGKACALITDGRFSGGTSGLSIGHVSPEAASGGNIAL
IEDGDMIAIDIPNRSIQLQLSDAEIAARREAQEARGDQAWTPKNRQRQVSFALRAYASLA
TSADKGAVRDKSKLGG
NT seq 1851 nt NT seq  +upstreamnt  +downstreamnt
atgcctaagtaccgttccgccaccaccacacatggccgcaatatggcgggcgcccgcgcg
ttgtggcgcgcaaccggaatgaccgatgccgatttcggcaaaccgattatcgccgtcgtt
aactcctttacccagtttgtccccgggcacgtgcacctgcgcgatctcggcaaactggtt
gccgagcagattgaagccgccggtggcgtggccaaagaattcaacaccatcgcagtggat
gatgggatcgctatgggccacgggggtatgctctattcactgccatcccgcgagctgatc
gccgactcggtggagtatatggttaacgcccactgcgctgatgccatggtttgtatctcc
aactgcgacaaaatcaccccggggatgctgatggcctccctgcgtttgaatattccggtg
atctttgtttccggcggcccgatggaagccgggaagaccaagctgtcagataaaatcatc
aagcttgacctggtggatgcgatgattcagggggcggatccgaaagtgtccgacgagcag
agtaatcaggtggaacgctccgcctgcccgacctgcggctcctgttccgggatgttcacg
gcgaactccatgaactgcctgaccgaagcgctgggcctgtcacaaccgggcaacggctct
ctgctggcgacccacgccgatcgtaaggagctgttcctaaacgccgggaaacgtatcgtg
gagctgaccaaacgctattacgagcaggatgacgcttccgcgctgccgcgcaatatcgcc
agcaaggcggcctttgagaacgctatgacgctggatatcgccatgggcggctccaccaat
accgttctgcacctgctggcggcggcgcaggaagctgaaatcgacttcaccatgagcgat
atcgataagctctcccgcaaagtgccgcagctgtgtaaggtggcgccgagcacgcagaaa
taccatatggaagatgtgcatcgcgccggcggcgtgctgggcattctgggcgagctggac
cgcgccgggctgctgaatcgcgaggtcaaaaacgtccttggcctgacgctgccgcagacc
ctggaacagtacgatgtgatggtgacccaggacgacgcggtgaaaaaaatgttccgcgcc
ggcccggcgggcattcgtaccacccaggcgttctcgcaagactgccgctgggataccctg
gatgacgatcgcgccgaaggctgtatccgttctctggaacacgcttacagcaaggacggc
ggcctggcggtgctgtacggcaatttcgcggaaaacggttgtatcgtgaaaaccgccggc
gtggacgacagcatcctgaaatttaccggtccggcgaaagtatatgagagccaggacgat
gcagttgaggctatcctcggcggtaaagtcgtggaaggcgacgtcgtggtgatccgctac
gaagggccgaaaggcgggccggggatgcaggaaatgctttaccccaccagcttcctgaag
tcgatggggctgggcaaagcgtgcgcgctgatcaccgatggccgtttctccggcggcacc
tcagggctctctatcggccacgtctctccggaagcggcgagcggcggcaacattgcgctc
attgaagatggcgacatgatcgcgattgatattccgaaccgcagcatccagctgcagctg
agcgatgcggaaattgcggcgcgtcgtgaagcccaggaagcgcgtggcgaccaggcgtgg
acgccgaagaatcgccagcgtcaggtctcctttgctcttcgcgcctacgccagcctggcg
accagcgccgacaaaggcgcggtacgcgataaatccaagctgggtggctaa

DBGET integrated database retrieval system