KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_00645Help
Entry
KPNIH30_00645     CDS       T03466                                 

Definition
(GenBank) threonine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00260  Glycine, serine and threonine metabolism
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01200  Carbon metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPNIH30_00645
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_00645
Enzymes [BR:kpw01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     KPNIH30_00645
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP Thr_dehydrat_C
Motif
Other DBs
NCBI-ProteinID: AIX76808
UniProt: A0A232LCI8
Position
134157..135701
Genome map
AA seq 514 aa AA seqDB search
MADSQPLSGAPEGAEYLRAVLRAPVYEAVQKTPLQKMDKLSSRLDNVILVKREDRQPVHS
FKLRGAYAMMSSLTAEQKSHGVITASAGNHAQGVAFSASRLGVKALIVMPVATADIKVDA
VRGFGGEVLLHGANFDEAKARAIELAQQQGFTWVPPFDHPMVIAGQGTLALELLQQDAHI
DRVFVPVGGGGLAAGVAVLIKQLMPQIKVIAVEAEDSACLKAALDAGHPVDLPRVGLFAE
GVAVKRIGDETFRLCQEYLDDIITVDSDAICAAMKDLFEDVRAVAEPSGALALAGMKKYI
AQHNIRGERLAHILSGANVNFHGLRYVSERCELGEQREALLAVTIPEEKGSFLKFCQLLG
GRSVTEFNYRFADAKDACIFVGVRLSRGLEERKEILQLLNDGGYSVVDLSDDEMAKLHVR
YMVGGRPSKALQERLFSFEFPESPGALLKFLHTLGTHWNISLFHYRSHGTDYGRVLAAFE
LGEHEPDFETRLNELGYECHDETHNPAFRFFLAG
NT seq 1545 nt NT seq  +upstreamnt  +downstreamnt
atggcggattcacaacccttgtccggcgcccctgagggcgccgagtacctgagagcagtg
ctgcgcgcgccggtttatgaagcggtgcagaaaacgccgctgcaaaaaatggataagctc
tcgtcgcggctggataacgttattctggtgaagcgtgaagatcgccagccggtacacagc
tttaagctgcgtggcgcttacgcgatgatgtccagcctgactgccgaacagaaatcccac
ggggtgatcaccgcttcggcgggcaaccatgcccagggcgtggcgttttccgcatcgcgg
ctgggcgttaaggcgctgatcgtgatgccggtagcgaccgccgatatcaaagtcgatgcc
gttcgcggctttggcggcgaagtgctgctgcacggcgccaactttgacgaagcgaaggcg
agagcgattgagctggcgcaacagcagggttttacctgggtgccgccgttcgatcaccca
atggtcatcgccggacagggaaccctggcgctggagctgctgcagcaggatgcccatatt
gaccgcgtattcgtcccggtgggcggcggcggtctggcagcgggcgtggcggtgctgatc
aagcaactgatgccgcagatcaaagtgatcgcggtggaggcggaagattctgcttgcctg
aaggcggcgctggacgcaggccatccggtggatctgccgcgcgtcggcttgtttgccgaa
ggcgtggcggtcaaacgcatcggcgatgaaacgttccgtttatgccaggagtatctggac
gatatcatcaccgtcgatagcgatgctatctgcgcggcgatgaaggatctgttcgaagat
gtgcgggcggtggcggagccttccggcgcgctggcgctggcggggatgaaaaagtatatc
gcccagcataacatccgcggcgagcgtctggctcatattctgtccggggccaacgtcaac
ttccatggcctgcgctacgtgtccgagcgctgcgagctcggggaacagcgggaagcgctg
ctggcggtgacgatcccggaagagaaaggtagctttttgaagttttgccagctactgggg
ggccgctcagtgacggagttcaactaccgctttgccgatgccaaagacgcctgtattttt
gtcggggtacgcctgagtcgtggcctggaagagcggaaagagatcctccagttactgaac
gacggcggctacagcgtggtggatctctctgatgatgagatggctaagctgcatgtgcgc
tatatggtcggcggccggccgtcaaaagcgctgcaggagcggctgttcagcttcgagttt
ccggaatcgccgggggcgctgctgaaattcctgcatacccttggcacccactggaatatt
tcactgttccactaccgcagccacggcactgactatggtcgggtactggcggccttcgag
ttgggcgagcacgagccggactttgaaactcgtctcaatgagctgggctatgagtgccac
gacgaaacgcataacccggcattccgctttttcctcgcgggttag

KEGG   Klebsiella pneumoniae subsp. pneumoniae KPNIH30: KPNIH30_16750Help
Entry
KPNIH30_16750     CDS       T03466                                 

Definition
(GenBank) threonine dehydratase
  KO
K01754  threonine dehydratase [EC:4.3.1.19]
Organism
kpw  Klebsiella pneumoniae subsp. pneumoniae KPNIH30
Pathway
kpw00260  Glycine, serine and threonine metabolism
kpw00290  Valine, leucine and isoleucine biosynthesis
kpw01100  Metabolic pathways
kpw01110  Biosynthesis of secondary metabolites
kpw01130  Biosynthesis of antibiotics
kpw01200  Carbon metabolism
kpw01230  Biosynthesis of amino acids
Module
kpw_M00570  Isoleucine biosynthesis, threonine => 2-oxobutanoate => isoleucine
Brite
KEGG Orthology (KO) [BR:kpw00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00260 Glycine, serine and threonine metabolism
    KPNIH30_16750
   00290 Valine, leucine and isoleucine biosynthesis
    KPNIH30_16750
Enzymes [BR:kpw01000]
 4. Lyases
  4.3  Carbon-nitrogen lyases
   4.3.1  Ammonia-lyases
    4.3.1.19  threonine ammonia-lyase
     KPNIH30_16750
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PALP HTH_9
Motif
Other DBs
NCBI-ProteinID: AIX79817
UniProt: A0A1Y0PYW9
Position
complement(3298788..3299777)
Genome map
AA seq 329 aa AA seqDB search
MHITYDLPVSIDDILEAKQRLAGKIYKTGMPRSNYFSERCQGEIFLKFENMQRTGSFKIR
GAFNKLCGLTAAEKRKGVVACSAGNHAQGVSLSCAMLGIDGKVVMPKGAPKSKVAATCDY
SAEVVLHGDNFNDTLAKASDIVELEGRIFIPPYDDPQVIAGQGTIGLEILEDLYDVDNVI
VPIGGGGLIAGIAIAIKSINPTIRIIGVQSENVHGMAASWYAGEITSHRHAGTLADGCDV
ARPGKLTYEIARQLVDDIVLVSEDDIRQSMVALIQRNKVITEGAGALACAALLSGKLDSY
IQNRKTVSLISGGNIDLSRVSQITGFVDA
NT seq 990 nt NT seq  +upstreamnt  +downstreamnt
atgcatattacctacgatcttccggtatctattgacgatattctcgaagcgaaacaacgc
ctcgcgggaaaaatatataaaacaggcatgccccgttcgaattattttagcgagcgctgc
cagggcgaaatatttcttaaattcgaaaatatgcagcgcacgggttcatttaaaattcgc
ggcgcctttaataaactgtgcggtttaaccgcggcggaaaaacgcaaaggggtggtggcc
tgctcagcgggcaaccacgcccagggcgtctcgctctcctgcgccatgctcggcattgac
gggaaagtggtgatgccgaaaggggcgccgaaatcaaaagttgccgccacctgtgattat
tcggcggaagtggtgctacatggcgataactttaacgataccctcgccaaagccagcgat
atcgttgaacttgagggccgcatttttattcccccctatgacgacccgcaggttatcgcc
gggcaggggacgattggactcgaaatattagaagatctgtatgacgtggataatgtcatc
gtgcccattggcggcggcggcttaattgccggtatcgcgattgcgattaaatccattaac
ccgacaatccgcattatcggcgtgcagtcggagaatgttcacggcatggccgcctcttgg
tatgccggggaaatcaccagccatcgccacgccggcaccttagccgatggttgcgacgtc
gcccgcccggggaaactgacctatgaaatcgcccgccagctggtggatgacatcgtcctg
gtgagtgaggatgacattcgccagagcatggtcgccttaattcagcgcaataaagtgatc
accgaaggggccggggcgttagcctgcgccgcgttattaagcggcaaactcgacagctat
atccagaaccgcaaaacggtcagcctgatttccgggggcaatatcgatctctcccgggta
tcgcaaattaccggttttgttgacgcttaa

DBGET integrated database retrieval system